Stub1 (NM_019719) Mouse Tagged ORF Clone

CAT#: MR204258

  • TrueORF®

Stub1 (Myc-DDK-tagged) - Mouse STIP1 homology and U-Box containing protein 1 (Stub1)

ORF Plasmid: DDK tGFP



  "NM_019719" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Cited in 2 publications.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 0610033N24Rik; 2210017D18Rik; 2310040B03Rik; AW046544; Chip
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204258 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGGCAAGGAGGAAAAGGAGGGCGGCGCGCGGCTGGGCACTGGTGGCGGCGGCAGCCCTGATAAGA
GCCCGAGTGCGCAAGAGCTCAAGGAGCAGGGAAACCGGCTCTTCGTGGGCCGCAAGTACCCGGAGGCGGC
GGCCTGCTACGGCCGCGCCATCACTCGGAACCCACTTGTGGCAGTGTACTACACTAACCGGGCCCTGTGC
TATCTGAAGATGCAGCAGCCTGAACAGGCACTTGCTGACTGCCGGCGAGCCCTGGAGCTGGACGGGCAGT
CTGTGAAGGCGCACTTCTTCCTGGGGCAGTGCCAGCTGGAGATGGAGAGTTATGATGAGGCCATTGCCAA
TCTGCAGCGAGCCTATAGTTTGGCCAAGGAGCAGCGACTCAACTTTGGGGATGATATTCCTAGTGCCCTT
CGCATTGCTAAGAAGAAGCGCTGGAACAGTATCGAGGAACGGCGCATCCACCAGGAGAGTGAGCTGCATT
CATATCTCACCAGGCTCATTGCTGCTGAGCGAGAGAGGGAACTGGAGGAGTGTCAGCGGAACCACGAGGG
TCATGAAGATGATGGCCACATCCGGGCCCAGCAGGCCTGCATTGAGGCCAAGCACGATAAATACATGGCA
GATATGGATGAGCTCTTCTCTCAGGTGGACGAGAAAAGAAAGAAGCGAGATATCCCTGACTACTTGTGTG
GCAAGATTAGCTTTGAGCTGATGCGGGAACCCTGCATTACACCCAGTGGTATCACCTATGACCGCAAGGA
CATTGAGGAGCACCTGCAGCGTGTGGGCCACTTTGACCCTGTGACCCGGAGCCCTCTGACCCAGGAACAG
CTCATCCCCAACTTGGCCATGAAGGAAGTCATTGACGCTTTCATCTCTGAGAACGGCTGGGTAGAGGACT
AT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204258 protein sequence
Red=Cloning site Green=Tags(s)

MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALC
YLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSAL
RIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMA
DMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQ
LIPNLAMKEVIDAFISENGWVEDY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019719
ORF Size 915 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019719.4
RefSeq Size 1672 bp
RefSeq ORF 915 bp
Locus ID 56424
UniProt ID Q9WUD1
MW 34.9 kDa
Gene Summary E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. Collaborates with ATXN3 in the degradation of misfolded chaperone substrates: ATXN3 restricting the length of ubiquitin chain attached to STUB1/CHIP substrates and preventing further chain extension. Ubiquitinates NOS1 in concert with Hsp70 and Hsp40. Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. Mediates polyubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. Mediates polyubiquitination of CYP3A4. Ubiquitinates EPHA2 and may regulate the receptor stability and activity through proteasomal degradation. Negatively regulates the suppressive function of regulatory T-cells (Treg) during inflammation by mediating the ubiquitination and degradation of FOXP3 in a HSPA1A/B-dependent manner (PubMed:23973223). Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and promotes ubiquitin-mediated protein degradation. Likely mediates polyubiquitination and downregulates plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity. Negatively regulates TGF-beta signaling by modulating the basal level of SMAD3 via ubiquitin-mediated degradation (By similarity). May regulate myosin assembly in striated muscles together with UBE4B and VCP/p97 by targeting myosin chaperone UNC45B for proteasomal degradation (By similarity). Mediates ubiquitination of RIPK3 leading to its subsequent proteasome-dependent degradation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)

Other Versions

Customer Reviews 
Loading...