Elavl1 (BC016194) Mouse Tagged ORF Clone

CAT#: MR204748

  • TrueORF®

Elavl1 (Myc-DDK-tagged) - Mouse ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (cDNA clone MGC:27577

ORF Plasmid: DDK tGFP



  "BC016194" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 6,365.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms HUR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204748 representing BC016194
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAATGGTTATGAAGACCACATGGCGGAAGACTGCAGGGATGACATTGGGAGAACGAATTTAATTG
TCAACTACCTCCCTCAGAACATGACCCAAGAGGAACTACGAAGTCTGTTCAGCAGCATTGGCGAGGTTGA
ATCTGCAAAGCTTATTCGGGATAAAGTAGCAGGACACAGCTTGGGCTACGGTTTTGTGAACTATGTGACT
GCAAAAGATGCAGAGAGAGCAATCAGCACACTGAACGGCTTGAGACTCCAGTCCAAAACCATTAAGGTGT
CATATGCTCGCCCAAGCTCAGAGGTCATCAAAGATGCCAACTTATACATCAGTGGGCTCCCAAGGACCAT
GACACAGAAGGATGTGGAAGACATGTTTTCTCGGTTTGGGCGAATCATCAACTCCAGGGTCCTTGTGGAT
CAGACCACAGGTTTGTCCAGAGGGGTTGCCTTTATCCGGTTTGACAAACGGTCAGAAGCAGAAGAGGCAA
TTACCAGTTTCAATGGTCATAAACCCCCAGGTTCCTCCGAGCCCATCACAGTGAAGTTTGCAGCCAATCC
CAACCAGAACAAAAACATGGCTCTCCTCTCGCAGCTGTACCACTCGCCTGCTAGGCGGTTTGGAGGCCCT
GTACACCACCAGGCACAGAGATTCAGGTTCTCCCCTATGGGTGTAGATCACATGAGTGGGATTTCTGGTG
TCAATGTCCCCGGCAATGCTTCCTCGGGCTGGTGCATCTTCATCTACAACCTTGGGCAAGACGCCGATGA
GGGGATCCTCTGGCAGATGTTTGGCCCCTTTGGTGCAGTTACCAATGTGAAAGTGATTCGTGATTTCAAC
ACCAACAAGTGCAAAGGGTTTGGTTTTGTGACCATGACAAACTATGAAGAAGCTGCAATGGCCATAGCAA
GTCTGAACGGCTACCGCCTGGGGGACAAAATTTTACAGGTTTCCTTCAAAACCAACAAGTCCCACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204748 representing BC016194
Red=Cloning site Green=Tags(s)

MSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT
AKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNMALLSQLYHSPARRFGGP
VHHQAQRFRFSPMGVDHMSGISGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC016194
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC016194
RefSeq Size 2475 bp
RefSeq ORF 980 bp
Locus ID 15568
MW 90.8 kDa
Gene Summary RNA-binding protein that binds to the 3' UTR region of mRNAs and increases their stability. Involved in embryonic stem cells (ESCs) differentiation: preferentially binds mRNAs that are not methylated by N6-methyladenosine (m6A), stabilizing them, promoting ESCs differentiation (PubMed:24394384). Binds to poly-U elements and AU-rich elements (AREs) in the 3' UTR of target mRNAs. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA, and AUUUUUA motifs. Binds preferentially to the 5'-UUUU[AG]UUU-3' motif in vitro (By similarity). With ZNF385A, binds the 3' UTR of p53/TP53 mRNA to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind with ZNF385A the CCNB1 mRNA (PubMed:21402775). Increases the stability of the leptin mRNA harboring an AU-rich element (ARE) in its 3' UTR (PubMed:27616329).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...