Irf1 (NM_001159396) Mouse Tagged ORF Clone
CAT#: MR204833
- TrueORF®
Irf1 (Myc-DDK-tagged) - Mouse interferon regulatory factor 1 (Irf1), transcript variant 2
"NM_001159396" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 1,416.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AU020929; Irf-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR204833 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCAATCACTCGAATGCGGATGAGACCCTGGCTAGAGATGCAGATTAATTCCAACCAAATCCCAGGGC TGATCTGGATCAATAAAGAAGAGATGATCTTCCAGATTCCATGGAAGCACGCTGCTAAGCACGGCTGGGA CATCAACAAGGATGCCTGTCTGTTCCGGAGCTGGGCCATTCACACAGGCCGATACAAAGCAGGAGAAAAA GAGCCAGATCCCAAGACATGGAAGGCAAACTTCCGTTGTGCCATGAACTCCCTGCCAGACATCGAGGAAG TGAAGGATCAGAGTAGGAACAAGGGCAGCTCTGCTGTGCGGGTGTACCGGATGCTGCCACCCCTCACCAG GAACCAGAGGAAAGAGAGAAAGTCCAAGTCCAGCCGAGACACTAAGAGCAAAACCAAGAGGAAGCTGTGT GGAGATGTTAGCCCGGACACTTTCTCTGATGGACTCAGCAGCTCTACCCTACCTGATGACCACAGCAGTT ACACCACTCAGGGCTACCTGGGTCAGGACTTGGATATGGAAAGGGACATAACTCCAGCACTGTCACCGTG TGTCGTCAGCAGCAGTCTCTCTGAGTGGCATATGCAGATGGACATTATACCAGATAGCACCACTGATCTG TATAACCTACAGGTGTCACCCATGCCTTCCACCTCCGAAGCCGCAACAGACGAGGATGAGGAAGGGAAGA TAGCCGAAGACCTTATGAAGCTCTTTGAACAGTCTGAGTGGCAGCCGACACACATCGATGGCAAGGGATA CTTGCTCAATGAGCCAGGGACCCAGCTCTCTTCTGTCTATGGAGACTTCAGCTGCAAAGAGGAACCAGAG ATTGACAGCCCTCGAGGGGACATTGGGATAGGCATACAACATGTCTTCACGGAGATGAAGAATATGGACT CCATCATGTGGATGGACAGCCTGCTGGGCAACTCTGTGAGGCTGCCGCCCTCTATTCAGGCCATTCCTTG TGCACCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR204833 protein sequence
Red=Cloning site Green=Tags(s) MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKERKSKSSRDTKSKTKRKLC GDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDITPALSPCVVSSSLSEWHMQMDIIPDSTTDL YNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPE IDSPRGDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001159396 |
ORF Size | 990 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001159396.1, NP_001152868.1 |
RefSeq Size | 2106 bp |
RefSeq ORF | 990 bp |
Locus ID | 16362 |
UniProt ID | P15314 |
MW | 37.3 kDa |
Gene Summary | Transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. These include the regulation of IFN and IFN-inducible genes, host response to viral and bacterial infections, regulation of many genes expressed during hematopoiesis, inflammation, immune responses and cell proliferation and differentiation, regulation of the cell cycle and induction of growth arrest and programmed cell death following DNA damage. Stimulates both innate and acquired immune responses through the activation of specific target genes and can act as a transcriptional activator and repressor regulating target genes by binding to an interferon-stimulated response element (ISRE) in their promoters. Its target genes for transcriptional activation activity are: genes involved in anti-viral response, such as IFN-alpha/beta, DDX58/RIG-I, TNFSF10/TRAIL, OAS1/2, PIAS1/GBP, EIF2AK2/PKR and RSAD2/viperin; antibacterial response, such as NOS2/INOS; anti-proliferative response, such as p53/TP53, LOX and CDKN1A; apoptosis, such as BBC3/PUMA, CASP1, CASP7 and CASP8; immune response, such as IL7, IL12A/B and IL15, PTGS2/COX2 and CYBB; DNA damage responses and DNA repair, such as POLQ/POLH; MHC class I expression, such as TAP1, PSMB9/LMP2, PSME1/PA28A, PSME2/PA28B and B2M and MHC class II expression, such as CIITA. Represses genes involved in anti-proliferative response, such as BIRC5/survivin, CCNB1, CCNE1, CDK1, CDK2 and CDK4 and in immune response, such as FOXP3, IL4, ANXA2 and TLR4. Stimulates p53/TP53-dependent transcription through enhanced recruitment of EP300 leading to increased acetylation of p53/TP53. Plays an important role in immune response directly affecting NK maturation and activity, macrophage production of IL12, Th1 development and maturation of CD8+ T-cells. Also implicated in the differentiation and maturation of dendritic cells and in the suppression of regulatory T (Treg) cells development. Acts as a tumor suppressor and plays a role not only in antagonism of tumor cell growth but also in stimulating an immune response against tumor cells.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Interferon regulatory factor 1(IRF-1) activates anti-tumor immunity via CXCL10/CXCR3 axis in hepatocellular carcinoma (HCC)
,Yan, Y;Zheng, L;Du, Q;Yazdani, H;Dong, K;Guo, Y;Geller, DA;,
Cancer letters
,PubMed ID 33689775
[IRF1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MR204833L3 | Lenti ORF clone of Irf1 (Myc-DDK-tagged) - Mouse interferon regulatory factor 1 (Irf1), transcript variant 2 |
CNY 4,750.00 |
|
MR204833L4 | Lenti ORF clone of Irf1 (mGFP-tagged) - Mouse interferon regulatory factor 1 (Irf1), transcript variant 2 |
CNY 4,750.00 |