Pip5k1a (BC003763) Mouse Tagged ORF Clone

CAT#: MR205375

  • TrueORF®

Pip5k1a (Myc-DDK-tagged) - Mouse phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha (cDNA clone MGC:5928 IMAGE:3591003)

ORF Plasmid: DDK tGFP



  "BC003763" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,520.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms PI4P5K-I[a]; PIP5K1-alpha; PIP5KIalpha; Pipk5a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205375 representing BC003763
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCGCCTCCTCAGGGCCAGCGGCGGCCGGGTTTTCATCCCTTGATGCCGGGGCCCCTGCTGGTA
CCGCAGCAGCAGCATCTGGAATCAAGAGAGCCACAGTATCTGAGGGACCTTCCGCCTCTGTCATGCCTGT
TAAAAAAATAGGCCATCGAAGTGTTGATTCCTCTGGAGAGACTACATACAAGAAGACAACTTCATCAGCC
TTGAAAGGTGCCATCCAGTTAGGCATCACTCACACTGTGGGCAGCCTGAGCACCAAACCAGAGCGTGATG
TCCTCATGCAAGACTTCTACGTGGTGGAGAGCATCTTTTTCCCCAGTGAAGGCAGCAACCTGACACCAGC
TCACCATTACAGTGACTTTCGATTCAAGACCTATGCGCCTGTTGCCTTCCGTTACTTCAGAGAGCTCTTT
GGCATCCGGCCTGATGATTACTTGTACTCCCTTTGCAGTGAGCCATTGATTGAACTCTCCAATTCTGGAG
CTAGTGGTTCCCTCTTCTATGTGTCCAGTGATGATGAATTCATCATTAAGACCGTCCAGCATAAAGAAGC
AGAATTTCTGCAGAAGTTGCTTCCAGGATACTACATGAATCTTAACCAAAACCCTCGTACTTTGCTGCCC
AAATTTTATGGATTGTACTGTGTGCAAGCAGGCGGCAAGAACATACGAATTGTGGTGATGAACAATCTCT
TGCCTCGGTCAGTCAACACAGTGTTCAAGAAGATTCCCTTGAAGCCTTCTCCTACCAAAAAGTTTCGGTC
TGGCCCGTCTTTCTCTCGGCGATCAGGCCCCAGCGGCAACTCCTGCACCTCCCAGCTGATGGCCTCTGGG
GAACACAGAGCACAAGTGACCACCAAGGCGGAAGTGGAGCCAGATGTACACCTTGGGCGTCCTGATGTCT
TACCTCAGACTCCACCTTTGGAGGAAATAAGTGAGGGTTCACCTGTTCCTGGCCCCAGTTTCTCACCTGT
AGTTGGACAACCTTTGCAAATACTAAATTTGAGTTCAACCTTGGAAAAGCTTGATGTTGCAGAGTCAGAG
TTCACCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205375 representing BC003763
Red=Cloning site Green=Tags(s)

MASASSGPAAAGFSSLDAGAPAGTAAAASGIKRATVSEGPSASVMPVKKIGHRSVDSSGETTYKKTTSSA
LKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYSDFRFKTYAPVAFRYFRELF
GIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLP
KFYGLYCVQAGGKNIRIVVMNNLLPRSVNTVFKKIPLKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASG
EHRAQVTTKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLSSTLEKLDVAESE
FTH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC003763
ORF Size 1059 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC003763.1
RefSeq Size 2723 bp
RefSeq ORF 1061 bp
Locus ID 18720
MW 99.8 kDa
Gene Summary Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as actin cytoskeleton organization, cell adhesion, migration and phagocytosis. Required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of RAC1 to the plasma membrane. Together with PIP5K1C is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle ingestion by activating WAS that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup. Together with PIP5K1B is required after stimulation of G-protein coupled receptors for stable platelet adhesion. Plays a role during calcium-induced keratinocyte differentiation. Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphate that mobilize internal calcium and drive keratinocyte differentiation. Together with PIP5K1C have a role during embryogenesis. Functions also in the nucleus where acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:10679324, PubMed:18772378, PubMed:19153220, PubMed:20622009, PubMed:8798574). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (PubMed:27739494).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...