Mapkapk2 (NM_008551) Mouse Tagged ORF Clone

CAT#: MR206027

  • TrueORF®

Mapkapk2 (Myc-DDK-tagged) - Mouse MAP kinase-activated protein kinase 2 (Mapkapk2)



  "NM_008551" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AA960234; MAPKAP-K2; MK-2; MK2; Rps6kc1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206027 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCGGGCTCTCCGGGCCAGACTCCGCCGGCGCCTTTCCCCAGCCCTCCACCGCCAGCCCCGGCCC
AGCCGCCGCCGCCGTTCCCCCAGTTCCACGTCAAGTCGGGCCTGCAGATCCGAAAGAACGCCATCACCGA
CGACTACAAGGTCACCAGCCAAGTGCTTGGCCTGGGCATCAACGGGAAGGTGCTGCGGATCTTCGACAAG
AGAACCCAGCAAAAATTCGCCCTAAAGATGCTCCAGGACTGTCCGAAGGCGCGCAGAGAGGTGGAGCTGC
ACTGGAGGGCCTCCCAGTGCCCACACATTGTGCACATCGTGGATGTCTATGAGAACCTGTATGCCGGGAG
GAAGTGCCTGCTGATTGTCATGGAGTGTCTCGATGGTGGAGAGCTCTTTAGTCGAATCCAGGACCGAGGA
GACCAGGCATTCACAGAAAGAGAGGCGTCAGAGATCATGAAGAGCATCGGCGAGGCCATCCAGTACCTGC
ACTCGATCAACATTGCTCACCGGGATGTCAAGCCTGAGAACCTCTTATATACTTCCAAAAGGCCCAATGC
CATTTTGAAACTCACTGATTTTGGCTTTGCCAAGGAAACCACCAGTCACAACTCTTTGACCACTCCGTGT
TATACACCATACTATGTGGCTCCGGAAGTCCTGGGCCCGGAGAAGTATGACAAGTCCTGTGACATGTGGT
CCTTGGGTGTCATCATGTATATTTTGCTGTGTGGGTATCCCCCCTTCTATTCCAATCACGGCCTTGCCAT
CTCTCCGGGCATGAAGACTCGTATTCGAATGGGCCAGTATGAATTTCCTAACCCGGAGTGGTCAGAAGTA
TCAGAAGAAGTGAAGATGCTTATCCGGAATCTGCTAAAAACAGAGCCCACCCAGAGAATGACCATCACAG
AATTCATGAACCACCCCTGGATCATGCAATCTACGAAGGTCCCTCAGACTCCACTGCACACCAGCCGTGT
CCTGAAGGAGGACAAGGAACGATGGGAGGATGTCAAGGAGGAGATGACCAGTGCCTTGGCCACGATGCGT
GTTGACTATGAGCAGATCAAGATAAAGAAGATAGAAGACGCATCCAACCCTCTGCTTCTCAAGAGGCGGA
AGAAAGCTCGTGCTGTGGAGGATGCGGCTCTCGCCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206027 protein sequence
Red=Cloning site Green=Tags(s)

MLSGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAITDDYKVTSQVLGLGINGKVLRIFDK
RTQQKFALKMLQDCPKARREVELHWRASQCPHIVHIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRG
DQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPC
YTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEV
SEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMR
VDYEQIKIKKIEDASNPLLLKRRKKARAVEDAALAH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008551
ORF Size 1161 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_008551.2
RefSeq Size 2586 bp
RefSeq ORF 1161 bp
Locus ID 17164
UniProt ID P49138
MW 44 kDa
Gene Summary Stress-activated serine/threonine-protein kinase involved in cytokine production, endocytosis, reorganization of the cytoskeleton, cell migration, cell cycle control, chromatin remodeling, DNA damage response and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAPK14, leading to phosphorylation of substrates. Phosphorylates serine in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue. Phosphorylates ALOX5, CDC25B, CDC25C, CEP131, ELAVL1, HNRNPA0, HSP27/HSPB1, KRT18, KRT20, LIMK1, LSP1, PABPC1, PARN, PDE4A, RCSD1, RPS6KA3, TAB3 and TTP/ZFP36. Phosphorylates HSF1; leading to the interaction with HSP90 proteins and inhibiting HSF1 homotrimerization, DNA-binding and transactivation activities (By similarity). Mediates phosphorylation of HSP27/HSPB1 in response to stress, leading to dissociation of HSP27/HSPB1 from large small heat-shock protein (sHsps) oligomers and impairment of their chaperone activities and ability to protect against oxidative stress effectively. Involved in inflammatory response by regulating tumor necrosis factor (TNF) and IL6 production post-transcriptionally: acts by phosphorylating AU-rich elements (AREs)-binding proteins ELAVL1, HNRNPA0, PABPC1 and TTP/ZFP36, leading to regulation of the stability and translation of TNF and IL6 mRNAs. Phosphorylation of TTP/ZFP36, a major post-transcriptional regulator of TNF, promotes its binding to 14-3-3 proteins and reduces its ARE mRNA affinity leading to inhibition of dependent degradation of ARE-containing transcripts. Phosphorylates CEP131 in response to cellular stress following ultraviolet irradiation which promotes binding of CEP131 to 14-3-3 proteins and inhibits formation of novel centriolar satellites (By similarity). Also involved in late G2/M checkpoint following DNA damage through a process of post-transcriptional mRNA stabilization: following DNA damage, relocalizes from nucleus to cytoplasm and phosphorylates HNRNPA0 and PARN, leading to stabilization of GADD45A mRNA. Involved in toll-like receptor signaling pathway (TLR) in dendritic cells: required for acute TLR-induced macropinocytosis by phosphorylating and activating RPS6KA3.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...