Actl6a (NM_019673) Mouse Tagged ORF Clone

CAT#: MR206846

  • TrueORF®

Actl6a (Myc-DDK-tagged) - Mouse actin-like 6A (Actl6a)

ORF Plasmid: DDK tGFP



  "NM_019673" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2810432C06Rik; Actl6; AI851094; ARP4; Baf53a; C79802
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206846 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGGCGGCGTGTACGGCGGAGATGAAGTTGGCGCTCTTGTTTTTGACATTGGATCGTACACAGTGA
GGGCTGGCTATGCTGGCGAGGACTGCCCTAAGGTTGATTTCCCCACGGCTATCGGTGTGGTGCTGGAGAG
AGATGACGGAAGTACAATGATGGAGATTGATGGTGACAAAGGCAAGCAGGGCGGGCCCACCTACTACATA
GACACCAATGCCCTCCGCGTGCCCAGGGAGAACATGGAGGCCATCTCACCACTCAAGAATGGCATGGTTG
AAGACTGGGATAGTTTCCAGGCCATTTTGGATCATACATACAAGATGCATGTCAAATCCGAAGCCAGCCT
GCATCCTGTTCTCATGTCGGAAGCACCGTGGAACACCAGGGCGAAGAGAGAGAAACTGACAGAGTTGATG
TTTGAGCACTACAGCATCCCTGCATTCTTCCTTTGCAAAACTGCAGTTTTGACGGCATTTGCTAATGGTC
GTTCTACTGGGCTGATTTTGGACAGTGGAGCTACCCACACCACTGCGATTCCAGTCCACGATGGCTATGT
TCTTCAACAAGGCATTGTGAAATCCCCTCTGGCTGGAGACTTCATTACCATGCAGTGCAGAGAACTCTTC
CAGGAAATGAACATAGAACTCATTCCTCCTTACATGATTGCATCAAAAGAGGCTGTTCGAGAAGGCTCTC
CAGCCAACTGGAAAAGAAAAGAGAAACTGCCCCAGGTTACAAGGTCTTGGCACAATTACATGTGCAACTG
CGTCATCCAGGATTTTCAAGCTTCCGTTCTTCAGGTGTCAGACTCCACCTACGACGAACAAGTGGCTGCA
CAGATGCCGACCGTTCACTACGAATTCCCCAACGGCTACAACTGCGATTTTGGGGCAGAGCGGCTGAAAA
TTCCTGAAGGGTTATTTGACCCTTCGAACGTAAAGGGACTGTCTGGGAACACGATGCTGGGAGTCAGTCA
CGTTGTCACAACCAGCGTCGGAATGTGTGACATCGACATCAGACCAGGTCTCTACGGCAGTGTGATCGTA
GCAGGAGGAAACACGCTAATACAGAGTTTCACTGACAGGTTAAATAGAGAGCTTTCTCAGAAAACTCCAC
CAAGTATGCGGTTGAAACTGATTGCAAACAACACGACGGTGGAGCGGAGGTTCAGCTCATGGATTGGTGG
CTCTATCCTAGCATCTTTGGGTACCTTTCAACAGATGTGGATTTCTAAACAGGAATATGAAGAAGGAGGG
AAGCAGTGTGTAGAAAGAAAATGCCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206846 protein sequence
Red=Cloning site Green=Tags(s)

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGVVLERDDGSTMMEIDGDKGKQGGPTYYI
DTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELM
FEHYSIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELF
QEMNIELIPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAA
QMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIV
AGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019673
ORF Size 1290 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019673.1, NM_019673.2, NP_062647.1, NP_062647.2
RefSeq Size 1969 bp
RefSeq ORF 1290 bp
Locus ID 56456
UniProt ID Q9Z2N8
MW 47.4 kDa
Gene Summary Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Required for maximal ATPase activity of SMARCA4/BRG1/BAF190A and for association of the SMARCA4/BRG1/BAF190A containing remodeling complex BAF with chromatin/nuclear matrix. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (PubMed:17640523). Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Putative core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...