Nrep (NM_053078) Mouse Tagged ORF Clone
CAT#: MR217640
- TrueORF®
Nrep (Myc-DDK-tagged) - Mouse DNA segment, human D4S114 (D0H4S114), transcript variant 1
ORF Plasmid: tGFP
"NM_053078" in other vectors (5)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,810.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AI325076; D0H4S114; Harp; P311; PTZ17; SEZ17 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR217640 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTTTACTACCCAGAACTCTTGGTCTGGGTCAGCCAAGAACCGTTTGCATACAAGGAAATGGAGGGAG GTCTTATTAAGGGAAGACTTCCCGTGCCTAAGGAAGTGAACCGAAAGAAGATGGAGGAGACTGGCGCTGC CTCGCTGACTCCGCCAGGCAGCCGTGAATTCACCTCTCCAGCTACCAGTTACCTCCACCCTTTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR217640 protein sequence
Red=Cloning site Green=Tags(s) MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSPATSYLHPF myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_053078 |
ORF Size | 204 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_053078.4, NP_444308.1 |
RefSeq Size | 2223 bp |
RefSeq ORF | 207 bp |
Locus ID | 27528 |
UniProt ID | Q07475 |
MW | 7.7 kDa |
Gene Summary | May have roles in cellular differentiation. Ectopic expression induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis. May also have neural functions. Promotes axonal regeneration and augments motility of gliomas. Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3. May play a role in the regulation of alveolar generation.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC209801 | Nrep (untagged) - Mouse DNA segment, human D4S114 (D0H4S114), transcript variant 1, (10ug) |
CNY 3,990.00 |
|
MG200058 | Nrep (tGFP-tagged) - Mouse DNA segment, human D4S114 (D0H4S114) |
CNY 2,850.00 |
|
MG217640 | Nrep (tGFP-tagged) - Mouse DNA segment human D4S114 (D0H4S114) transcript variant 1, (10ug) |
CNY 2,850.00 |
|
MR217640L3 | Lenti ORF clone of Nrep (Myc-DDK-tagged) - Mouse DNA segment, human D4S114 (D0H4S114), transcript variant 1 |
CNY 4,750.00 |
|
MR217640L4 | Lenti ORF clone of Nrep (mGFP-tagged) - Mouse DNA segment, human D4S114 (D0H4S114), transcript variant 1 |
CNY 4,750.00 |