Cbfb (NM_001161456) Mouse Tagged ORF Clone

CAT#: MR222350

  • TrueORF®

Cbfb (Myc-DDK-tagged) - Mouse core binding factor beta (Cbfb), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001161456" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,900.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI893578; PEA2; Pebp2; PEBP2b; Pebpb2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR222350 representing NM_001161456
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCGCGTCGTCCCGGACCAGAGGAGCAAGTTCGAGAACGAGGAGTTCTTCAGGAAGCTGAGCCGCG
AGTGCGAGATTAAGTACACGGGCTTCAGGGACCGGCCCCACGAGGAGCGCCAGACACGCTTCCAGAACGC
CTGCCGCGACGGTCGCTCGGAGATCGTATACTTGAAGGCTCCCATGATTCTGAATGGAGTGTGTGTTATA
TGGAAGGGCTGGATTGATCTCCACAGATTGGATGGTATGGGTTGCCTGGAGTTTGATGAGGAGCGAGCCC
AGCAGGAAGATGCATTAGCACAACAGGCCTTTGAAGAGGCTCGAAGAAGAACTCGAGAATTTGAGGATAG
AGACAGGTCTCACCGGGAGGAAATGGAGGCAAGAAGACAGCAAGACCCTAGTCCTGGTTCTAACTTAGGT
GGCGGTGATGATCTCAAACTTCGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR222350 representing NM_001161456
Red=Cloning site Green=Tags(s)

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIVYLKAPMILNGVCVI
WKGWIDLHRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLG
GGDDLKLR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001161456
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001161456.1, NP_001154928.1
RefSeq Size 2776 bp
RefSeq ORF 447 bp
Locus ID 12400
UniProt ID Q08024
MW 18.1 kDa
Gene Summary Forms the heterodimeric complex core-binding factor (CBF) with RUNX family proteins (RUNX1, RUNX2, and RUNX3). RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (Probable). CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation (PubMed:18258917).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...