Hnrnpa2b1 (NM_182650) Mouse Tagged ORF Clone

CAT#: MR223200

  • TrueORF®

Hnrnpa2b1 (Myc-DDK-tagged) - Mouse heterogeneous nuclear ribonucleoprotein A2/B1 (Hnrnpa2b1), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_182650" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


HNRNPA2B1 Antibody - C-terminal region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 9130414A06Rik; hnrnp-A; Hnrpa2; Hnrpa2b1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR223200 representing NM_182650
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGAGAAAAGGAACAGTTCCGAAAGCTCTTTATTGGTGGCTTAAGCTTTGAAACCACAGAAGAAA
GTTTGAGAAACTACTATGAGCAATGGGGAAAGCTCACAGACTGTGTGGTTATGCGGGATCCTGCAAGCAA
AAGATCAAGAGGATTTGGCTTTGTAACTTTCTCATCCATGGCCGAGGTTGACGCTGCCATGGCTGCAAGG
CCCCATTCCATTGATGGCAGGGTAGTTGAGCCAAAACGTGCTGTAGCAAGAGAGGAGTCTGGAAAACCAG
GAGCCCATGTGACTGTGAAGAAGCTGTTTGTTGGTGGAATTAAGGAAGATACTGAGGAACACCACCTTAG
AGATTACTTTGAAGAGTATGGAAAAATTGATACTATTGAAATAATTACCGATAGGCAGTCTGGAAAGAAA
AGAGGCTTTGGCTTTGTTACTTTTGATGACCATGATCCTGTGGATAAAATTGTCTTGCAAAAATATCACA
CCATAAATGGTCACAATGCAGAAGTTAGAAAGGCATTGTCTAGACAAGAAATGCAGGAAGTCCAAAGTTC
TAGGAGTGGAAGAGGAGGAAACTTTGGTTTTGGGGATTCTCGTGGTGGCGGTGGCAATTTTGGACCAGGA
CCAGGAAGCAACTTTAGGGGGGGATCTGATGGATACGGAAGTGGACGTGGATTTGGGGATGGCTATAATG
GGTATGGAGGAGGACCTGGAGGAAATTATGGAAGTGGAAGTTACAATGATTTTGGAAATTATAACCAGCA
GCCTTCTAACTATGGTCCAATGAAGAGTGGAAACTTTGGGGGTAGCAGGAACATGGGAGGACCATATGGT
GGAGGGAACTATGGTCCTGGAGGAAGTGGAGGAAGTGGTGGCTATGGTGGAAGGAGCAGATAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223200 representing NM_182650
Red=Cloning site Green=Tags(s)

MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAAR
PHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKK
RGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPG
PGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYG
GGNYGPGGSGGSGGYGGRSRY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_182650
ORF Size 903 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182650.4, NP_872591.1
RefSeq Size 1647 bp
RefSeq ORF 906 bp
Locus ID 53379
UniProt ID O88569
MW 32.9 kDa
Gene Summary Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm (By similarity). Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion (By similarity). Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...