Slamf6 (NM_030710) Mouse Tagged ORF Clone

CAT#: MR224443

  • TrueORF®

Slamf6 (Myc-DDK-tagged) - Mouse SLAM family member 6 (Slamf6)

ORF Plasmid: DDK tGFP



  "NM_030710" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms KAL1; KAL1b; Ly108; NTB-A; NTBA; SF2000
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR224443 representing NM_030710
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTCTCAAGGGCTCCAGCACCCGACTCCGCCTGTCAGAGGATGGTCTGGCTCTTTCCACTTGTCT
TCTGCCTCGGCTCAGGGAGTGAAGTTTCACAGAGCAGCTCAGACCCCCAGCTAATGAATGGCGTTCTAGG
AGAGTCTGCAGTTCTTCCTCTAAAGCTTCCTGCAGGGAAGATAGCCAATATCATCATCTGGAATTATGAA
TGGGAAGCGTCACAAGTCACTGCCCTCGTTATCAACCTAAGTAATCCTGAAAGTCCACAAATCATGAACA
CTGATGTAAAGAAGAGACTGAACATCACCCAGTCCTACTCCCTGCAAATCAGCAACCTTACCATGGCAGA
CACAGGATCATACACTGCGCAGATAACCACAAAGGACTCTGAAGTGATCACCTTCAAATATATTCTGAGG
GTCTTTGAACGACTGGGTAACTTAGAAACTACCAACTATACTCTCCTGCTAGAGAATGGGACCTGCCAGA
TACACCTGGCCTGTGTTTTGAAGAATCAAAGTCAAACTGTCTCAGTTGAGTGGCAAGCCACAGGAAACAT
CTCTTTAGGAGGACCAAATGTCACTATCTTTTGGGACCCGAGGAATTCTGGTGACCAGACTTACGTCTGC
AGAGCCAAGAATGCTGTCAGCAATTTGTCAGTCTCTGTTTCGACCCAGAGTCTCTGCAAAGGGGTTCTAA
CTAATCCACCCTGGAATGCAGTATGGTTTATGACTACAATTTCAATAATCAGTGCTGTCATACTCATCTT
TGTGTGCTGGAGCATACATGTTTGGAAGAGAAGAGGTTCTCTTCCTTTGACTAGCCAACATCCAGAGTCC
TCCCAGAGCACAGATGGCCCAGGCTCTCCAGGGAACACTGTGTATGCACAAGTCACTCGTCCAATGCAGG
AAATGAAAATCCCAAAACCTATCAAAAATGACTCCATGACAATTTACTCCATAGTTAATCATTCCAGAGA
GGCCGAATACTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR224443 representing NM_030710
Red=Cloning site Green=Tags(s)

MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYE
WEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILR
VFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVC
RAKNAVSNLSVSVSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPES
SQSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREAEYS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_030710
ORF Size 993 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_030710.3
RefSeq Size 2443 bp
RefSeq ORF 996 bp
Locus ID 30925
UniProt ID Q9ET39
MW 36.9 kDa
Gene Summary Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2 (PubMed:19648922). Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors (By similarity). Positive signaling in NK cells implicates phosphorylation of VAV1. NK cell activation seems to depend on SH2D1B and not on SH2D1A (By similarity). In conjunction with SLAMF1 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage (PubMed:18031695). Promotes T cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A (By similarity). Promotes recruitment of RORC to the IL-17 promoter (By similarity). In conjunction with SLAMF1 and CD84/SLAMF5 may be a negative regulator of the humoral immune response (PubMed:25926831). In the absence of SH2D1A/SAP can transmit negative signals to CD4(+) T-cells and NKT cells. Negatively regulates germinal center formation by inhibiting T-cell:B-cell adhesion; the function probably implicates increased association with PTPN6/SHP-1 via ITSMs in absence of SH2D1A/SAP (PubMed:22683125). However, reported to mediated T-cell adhesion, to participate in stable T-cell:B-cell interactions and to be involved in maintaining B-cell tolerance in germinal centers and in preventing autoimmunity (PubMed:20153220, PubMed:25801429). Involved in regulation of autoimmunity. Isoform 3 may be suppressor of pathogenic T-cell proliferation (PubMed:21422172).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...