Capzb (NM_001271406) Mouse Tagged ORF Clone

CAT#: MR228848

  • TrueORF®

Capzb (myc-DDK-tagged) - Mouse capping protein (actin filament) muscle Z-line, beta (Capzb), transcript variant 4



  "NM_001271406" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,570.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1700120C01Rik; AI325129; Cappb1; CPB1; CPB2; CPbeat2; CPbeta1; CPbeta2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228848 representing NM_001271406
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCGCCTGCCTCCACAGCAGATTGAGAAGAACCTCAGCGATCTGATCGACCTGGTCCCCAGTCTGT
GTGAAGATCTCCTGTCATCTGTTGACCAGCCCCTGAAAATTGCCAGAGACAAGGTGGTGGGCAAGGATTA
CCTTTTGTGTGACTACAACAGAGACGGGGACTCCTATAGGTCACCGTGGAGTAACAAGTATGACCCTCCT
TTGGAAGATGGGGCCATGCCATCTGCTCGGCTCAGAAAGCTGGAGGTAGAGGCCAACAATGCCTTCGACC
AATACCGAGACCTGTATTTTGAAGGTGGGGTCTCATCAGTCTACCTCTGGGATCTTGATCATGGCTTTGC
TGGAGTGATCCTCATAAAGAAAGCTGGAGATGGATCCAAGAAGATCAAAGGCTGCTGGGATTCCATCCAC
GTGGTGGAAGTGCAGGAGAAGTCCAGCGGCCGTACTGCCCATTACAAGTTGACCTCCACGGTGATGCTAT
GGCTGCAAACCAACAAATCCGGCTCGGGCACCATGAACCTGGGAGGCAGCCTAACCAGACAGATGGAGAA
AGACGAAACTGTGAGTGACTGTTCCCCACACATAGCCAACATCGGGCGCCTGGTGGAGGACATGGAAAAC
AAAATCCGAAGCACGCTGAATGAGATCTACTTTGGAAAAACAAAGGACATCGTCAACGGGCTGAGGTCTG
TGCAGACGTTTGCAGACAAATCAAAGCAAGAAGCGCTTAAGAACGACCTGGTGGAGGCCTTGAAGAGAAA
GCAGCAGTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228848 representing NM_001271406
Red=Cloning site Green=Tags(s)

MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
LEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIH
VVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMEN
KIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271406
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001271406.1, NP_001258335.1
RefSeq Size 1641 bp
RefSeq ORF 783 bp
Locus ID 12345
MW 29.7 kDa
Gene Summary This gene encodes the beta subunit of a highly conserved filamentous actin capping protein that binds the barbed end of filamentous actin to stabilize it and terminate elongation. Interaction of this protein with the barbed end of the actin filament occurs through binding of the amphipathic helix at the C-terminus to the hydrophobic cleft on the actin molecule. This gene is required for a variety of dynamic actin-mediated processes including organization of lamellipodia and filopodia, growth cone morphology and neurite outgrowth in hippocampal neurons, and asymmetric spindle migration and polar body extrusion during oocyte maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...