SOCS2 (NM_003877) Human Tagged ORF Clone
CAT#: RC203163
SOCS2 (Myc-DDK-tagged)-Human suppressor of cytokine signaling 2 (SOCS2)
ORF Plasmid: tGFP
"NM_003877" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CIS2; Cish2; SOCS-2; SSI-2; SSI2; STATI2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203163 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCCTGCGGTGCCTTGAGCCCTCCGGGAATGGCGGGGAAGGGACGCGGAGCCAGTGGGGGACCGCGG GGTCGGCGGAGGAGCCATCCCCGCAGGCGGCGCGTCTGGCGAAGGCCCTGCGGGAGCTCGGTCAGACAGG ATGGTACTGGGGAAGTATGACTGTTAATGAAGCCAAAGAGAAATTAAAAGAGGCACCAGAAGGAACTTTC TTGATTAGAGATAGCTCGCATTCAGACTACCTACTAACAATATCTGTTAAAACATCAGCTGGACCAACTA ATCTTCGAATCGAATACCAAGACGGAAAATTCAGATTGGACTCTATCATATGTGTCAAATCCAAGCTTAA ACAATTTGACAGTGTGGTTCATCTGATCGACTACTATGTTCAGATGTGCAAGGATAAGCGGACAGGTCCA GAAGCCCCCCGGAACGGCACTGTTCACCTTTATCTGACCAAACCGCTCTACACGTCAGCACCATCTCTGC AGCATCTCTGTAGGCTCACCATTAACAAATGTACCGGTGCCATCTGGGGACTGCCTTTACCAACAAGACT AAAAGATTACTTGGAAGAATATAAATTCCAGGTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203163 protein sequence
Red=Cloning site Green=Tags(s) MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTF LIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGP EAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_003877 |
ORF Size | 594 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003877.5 |
RefSeq Size | 2759 bp |
RefSeq ORF | 597 bp |
Locus ID | 8835 |
UniProt ID | O14508 |
Domains | SH2, SOCS |
Protein Families | Druggable Genome |
Protein Pathways | Insulin signaling pathway, Jak-STAT signaling pathway, Type II diabetes mellitus |
MW | 22.2 kDa |
Gene Summary | This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway (the JAK/STAT pathway). SOCS family proteins interact with major molecules of signaling complexes to block further signal transduction, in part, by proteasomal depletion of receptors or signal-transducing proteins via ubiquitination. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10, interferon (IFN)-gamma and by cytokine receptors such as growth horomone receptor. The protein encoded by this gene interacts with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R) and is thought to be involved in the regulation of IGF1R mediated cell signaling. This gene has pseudogenes on chromosomes 20 and 22. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Knockdown of m6A methyltransferase METTL3 in gastric cancer cells results in suppression of cell proliferation
,null,
Oncology Letters
,PubMed ID 32782536
[SOCS2]
|
m6A methyltransferase METTL3 maintains colon cancer tumorigenicity by suppressing SOCS2 to promote cell proliferation
,Xu, J;Chen, Q;Tian, K;Liang, R;Chen, T;Gong, A;Mathy, N;Yu, T;Chen, X;,
Oncol Rep
,PubMed ID 32705223
[SOCS2]
|
A growth hormone receptor SNP promotes lung cancer by impairment of SOCS2-mediated degradation
,Chhabra, Y;Wong, HY;Nikolajsen, LF;Steinocher, H;Papadopulos, A;Tunny, KA;Meunier, FA;Smith, AG;Kragelund, BB;Brooks, AJ;Waters, MJ;,
Oncogene
,PubMed ID 28967904
[SOCS2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203163L1 | Lenti ORF clone of Human suppressor of cytokine signaling 2 (SOCS2), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC203163L2 | Lenti ORF clone of Human suppressor of cytokine signaling 2 (SOCS2), mGFP tagged |
CNY 5,890.00 |
|
RC203163L3 | Lenti ORF clone of Human suppressor of cytokine signaling 2 (SOCS2), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC203163L4 | Lenti ORF clone of Human suppressor of cytokine signaling 2 (SOCS2), mGFP tagged |
CNY 4,800.00 |
|
RG203163 | SOCS2 (tGFP-tagged) - Human suppressor of cytokine signaling 2 (SOCS2) |
CNY 4,000.00 |
|
SC108265 | SOCS2 (untagged)-Human suppressor of cytokine signaling 2 (SOCS2) |
CNY 2,400.00 |
|
SC320892 | SOCS2 (untagged)-Human suppressor of cytokine signaling 2 (SOCS2) |
CNY 2,400.00 |