United States
Germany
Japan
United Kingdom
China
Phospholipase A2 IIA (PLA2G2A) (NM_000300) Human Tagged ORF Clone
CAT＃: RC203250
PLA2G2A (Myc-DDK-tagged)-Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1
ORF Plasmid: tGFP
"NM_000300" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Product images
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC203250 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGGAATTTGGTGA ATTTCCACAGAATGATCAAGTTGACGACAGGAAAGGAAGCCGCACTCAGTTATGGCTTCTACGGCTGCCA CTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAACGGATCGCTGCTGTGTCACTCATGACTGTTGC TACAAACGTCTGGAGAAACGTGGATGTGGCACCAAATTTCTGAGCTACAAGTTTAGCAACTCGGGGAGCA GAATCACCTGTGCAAAACAGGACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTG TTTTGCTAGAAACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGC ACCCCTCGTTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203250 protein sequence
Red=Cloning site Green=Tags(s) MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS TPRC myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_000300 |
| ORF Size | 432 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_000300.4 |
| RefSeq Size | 1017 bp |
| RefSeq ORF | 435 bp |
| Locus ID | 5320 |
| UniProt ID | P14555 |
| Domains | PA2c |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
| MW | 16.1 kDa |
| Gene Summary | The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.[provided by RefSeq, Sep 2009] |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC203250L1 | Lenti ORF clone of Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC203250L2 | Lenti ORF clone of Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
| RC203250L3 | Lenti ORF clone of Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC203250L4 | Lenti ORF clone of Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
| RG203250 | PLA2G2A (tGFP-tagged) - Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1 |
CNY 2,800.00 |
|
| SC119954 | PLA2G2A (untagged)-Human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A), transcript variant 1 |
CNY 2,950.00 |
其它Phospholipase A2 IIA产品
