United States
Germany
Japan
United Kingdom
China
RHOA (NM_001664) Human Tagged ORF Clone
CAT＃: RC203303
RHOA (Myc-DDK-tagged)-Human ras homolog gene family, member A (RHOA)
ORF Plasmid: tGFP
"NM_001664" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
| Cited in 2 publications. |
Product images
CNY 300.00
热销推荐Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | ARH12; ARHA; EDFAOB; RHO12; RHOH12 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC203303 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAG TCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGA GGTGGATGGAAAGCAGGTAGAATTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGG CCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAA ACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAA TAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAA CCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCA AAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAA ATCTGGGTGCCTTGTCTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203303 protein sequence
Red=Cloning site Green=Tags(s) MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_001664 |
| ORF Size | 579 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_001664.4 |
| RefSeq Size | 1926 bp |
| RefSeq ORF | 582 bp |
| Locus ID | 387 |
| UniProt ID | P61586 |
| Domains | ras, RAS, RHO, RAB |
| Protein Families | Druggable Genome |
| Protein Pathways | Adherens junction, Axon guidance, Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, T cell receptor signaling pathway, TGF-beta signaling pathway, Tight junction, Vascular smooth muscle contraction, Wnt signaling pathway |
| MW | 21.8 kDa |
| Gene Summary | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015] |
Citations (2)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Deregulation of Fragile X-related protein 1 by the lipodystrophic lamin A p.R482W mutation elicits a myogenic gene expression program in preadipocytes
,Oldenburg, AR;Delbarre, E;Thiede, B;Vigouroux, C;Collas, P;,
Hum Mol Genet. 2013 Oct 18
,PubMed ID 24108105
[RHOA]
|
|
HGAL, a germinal center specific protein, decreases lymphoma cell motility by modulation of the RhoA signaling pathway
,Xiaoyu Jiang, Xiaoqing Lu, George McNamara, Xiaofei Liu, Elena Cubedo, Kristopher A. Sarosiek, Isidro Sánchez-García, David M. Helfman, and Izidore S. Lossos,
Blood, Dec 2010; 116: 5217 - 5227
[RHOA]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC203303L1 | Lenti ORF clone of Human ras homolog gene family, member A (RHOA), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC203303L2 | Lenti ORF clone of Human ras homolog gene family, member A (RHOA), mGFP tagged |
CNY 6,000.00 |
|
| RC203303L3 | Lenti ORF clone of Human ras homolog gene family, member A (RHOA), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC203303L4 | Lenti ORF clone of Human ras homolog gene family, member A (RHOA), mGFP tagged |
CNY 6,000.00 |
|
| RG203303 | RHOA (tGFP-tagged) - Human ras homolog gene family, member A (RHOA) |
CNY 5,200.00 |
|
| SC321534 | RHOA (untagged)-Human ras homolog gene family, member A (RHOA) |
CNY 3,600.00 |
