CISD1 (NM_018464) Human Tagged ORF Clone
CAT#: RC203308
CISD1 (Myc-DDK-tagged)-Human CDGSH iron sulfur domain 1 (CISD1)
ORF Plasmid: tGFP
"NM_018464" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C10orf70; MDS029; mitoNEET; ZCD1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203308 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTCTGACTTCCAGTTCCAGCGTACGAGTTGAATGGATCGCAGCAGTTACCATTGCTGCTGGGACAG CTGCAATTGGTTATCTAGCTTACAAAAGATTTTATGTTAAAGATCATCGAAATAAAGCTATGATAAACCT TCACATCCAGAAAGACAACCCCAAGATAGTACATGCTTTTGACATGGAGGATTTGGGAGATAAAGCTGTG TACTGCCGTTGTTGGAGGTCCAAAAAGTTCCCATTCTGTGATGGGGCTCACACAAAACATAACGAAGAGA CTGGAGACAATGTGGGCCCTCTGATCATCAAGAAAAAAGAAACT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203308 protein sequence
Red=Cloning site Green=Tags(s) MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_018464 |
ORF Size | 324 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_018464.5 |
RefSeq Size | 2115 bp |
RefSeq ORF | 327 bp |
Locus ID | 55847 |
UniProt ID | Q9NZ45 |
Domains | ZnF_CDGSH |
Protein Families | Transmembrane |
MW | 12.2 kDa |
Gene Summary | This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Quantitative Proteomics of Presynaptic Mitochondria Reveal an Overexpression and Biological Relevance of Neuronal MitoNEET in Postnatal Brain Development
,Stauch, KL;Villeneuve, LM;Totusek, S;Lamberty, B;Ciborowski, P;Fox, HS;,
Dev Neurobiol
,PubMed ID 31050203
[CISD1]
|
Efavirenz induces neuronal autophagy and mitochondrial alterations
,Purnell, PR;Fox, HS;,
J. Pharmacol. Exp. Ther.
,PubMed ID 25161171
[CISD1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203308L1 | Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203308L2 | Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), mGFP tagged |
CNY 5,890.00 |
|
RC203308L3 | Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203308L4 | Lenti ORF clone of Human CDGSH iron sulfur domain 1 (CISD1), mGFP tagged |
CNY 3,600.00 |
|
RG203308 | CISD1 (tGFP-tagged) - Human CDGSH iron sulfur domain 1 (CISD1) |
CNY 2,800.00 |
|
SC113478 | CISD1 (untagged)-Human CDGSH iron sulfur domain 1 (CISD1) |
CNY 1,200.00 |