Ribonuclease A (RNASE1) (NM_198235) Human Tagged ORF Clone
CAT#: RC205620
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
ORF Plasmid: tGFP
"NM_198235" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | RAC1; RIB1; RNS1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205620 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCTGGAGAAGTCTCTTGTCCGGCTCCTTCTGCTTGTCCTGATACTGCTGGTGCTGGGCTGGGTCC AGCCTTCCCTGGGCAAGGAATCCCGGGCCAAGAAATTCCAGCGGCAGCATATGGACTCAGACAGTTCCCC CAGCAGCAGCTCCACCTACTGTAACCAAATGATGAGGCGCCGGAATATGACACAGGGGCGGTGCAAACCA GTGAACACCTTTGTGCACGAGCCCCTGGTAGATGTCCAGAATGTCTGTTTCCAGGAAAAGGTCACCTGCA AGAACGGGCAGGGCAACTGCTACAAGAGCAACTCCAGCATGCACATCACAGACTGCCGCCTGACAAACGG CTCCAGGTACCCCAACTGTGCATACCGGACCAGCCCGAAGGAGAGACACATCATTGTGGCCTGTGAAGGG AGCCCATATGTGCCAGTCCACTTTGATGCTTCTGTGGAGGACTCTACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205620 protein sequence
Red=Cloning site Green=Tags(s) MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG SPYVPVHFDASVEDST myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_198235 |
ORF Size | 468 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_198235.3 |
RefSeq Size | 903 bp |
RefSeq ORF | 471 bp |
Locus ID | 6035 |
UniProt ID | P07998 |
Protein Families | Secreted Protein, Transmembrane |
MW | 17.6 kDa |
Gene Summary | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Ribonuclease inhibitor 1 regulates erythropoiesis by controlling GATA1 mRNA translation
,Chennupati, V;Veiga, DF;Maslowski, KM;Andina, N;Tardivel, A;Yu, EC;Stilinovic, M;Simillion, C;Duchosal, MA;Quadroni, M;Roberts, I;Sankaran, VG;MacDonald, HR;Fasel, N;Angelillo-Scherrer, A;Schneider, P;Hoang, T;Allam, R;,
J. Clin. Invest.
,PubMed ID 29408805
[Ribonuclease A]
|
Ribonuclease inhibitor (RNH1) is a ribosome-associated protein and regulates erythropoiesis by controlling GATA1-specific mRNA translation
,Allam, R;Chennupati, V;Veiga, D;Maslowski, K;Tardivel, A;Andina, N;Chi-Wang Yu, E;Stilinovic, M;Simillion, C;Duchosal, M;Quadroni, M;Roberts, I;Sankaran, V;MacDonald, H;Fasel, N;Angelillo-Scherrer, A;Schneider, P;Hoang, T;,
Experimental Hematology
[Ribonuclease A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205620L3 | Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC205620L4 | Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG205620 | RNASE1 (tGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1 |
CNY 4,370.00 |
|
SC124287 | RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1 |
CNY 1,200.00 |
其它Ribonuclease A产品