Apolipoprotein CIII (APOC3) (NM_000040) Human Tagged ORF Clone
CAT#: RC206566
APOC3 (Myc-DDK-tagged)-Human apolipoprotein C-III (APOC3)
ORF Plasmid: tGFP
"NM_000040" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | APOCIII |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206566 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCTTCAGAGGCCG AGGATGCCTCCCTTCTCAGCTTCATGCAGGGTTACATGAAGCACGCCACCAAGACCGCCAAGGATGCACT GAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGGGGCTGGGTGACCGATGGCTTCAGTTCCCTG AAAGACTACTGGAGCACCGTTAAGGACAAGTTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAA CTTCAGCCGTGGCTGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206566 protein sequence
Red=Cloning site Green=Tags(s) MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL KDYWSTVKDKFSEFWDLDPEVRPTSAVAA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000040 |
ORF Size | 297 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000040.3 |
RefSeq Size | 533 bp |
RefSeq ORF | 300 bp |
Locus ID | 345 |
UniProt ID | P02656 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
MW | 10.9 kDa |
Gene Summary | This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs through multiple modes. This protein has been shown to promote the secretion of VLDL1, inhibit lipoprotein lipase enzyme activity, and delay catabolism of TRL remnants. Mutations in this gene are associated with low plasma triglyceride levels and reduced risk of ischemic cardiovascular disease, and hyperalphalipoproteinemia, which is characterized by elevated levels of high density lipoprotein (HDL) and HDL cholesterol in human patients. This gene and other related genes comprise an apolipoprotein gene cluster on chromosome 11. [provided by RefSeq, Sep 2017] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
A human APOC3 missense variant and monoclonal antibody accelerate apoC-III clearance and lower triglyceride-rich lipoprotein levels
,Khetarpal, SA;Zeng, X;Millar, JS;Vitali, C;Somasundara, AVH;Zanoni, P;Landro, JA;Barucci, N;Zavadoski, WJ;Sun, Z;de Haard, H;Toth, IV;Peloso, GM;Natarajan, P;Cuchel, M;Lund-Katz, S;Phillips, MC;Tall, AR;Kathiresan, S;DaSilva-Jardine, P;Yates, NA;Rader, DJ;,
Nat. Med.2017
,PubMed ID 28825717
[Apolipoprotein CIII]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206566L1 | Lenti ORF clone of Human apolipoprotein C-III (APOC3), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC206566L2 | Lenti ORF clone of Human apolipoprotein C-III (APOC3), mGFP tagged |
CNY 5,890.00 |
|
RC206566L3 | Lenti ORF clone of Human apolipoprotein C-III (APOC3), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC206566L4 | Lenti ORF clone of Human apolipoprotein C-III (APOC3), mGFP tagged |
CNY 3,600.00 |
|
RG206566 | APOC3 (tGFP-tagged) - Human apolipoprotein C-III (APOC3) |
CNY 2,800.00 |
|
SC113775 | APOC3 (untagged)-Human apolipoprotein C-III (APOC3) |
CNY 1,200.00 |
其它Apolipoprotein CIII产品