PDGF beta (PDGFB) (NM_002608) Human Tagged ORF Clone
CAT#: RC206587
PDGFB (Myc-DDK-tagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1
ORF Plasmid: tGFP
"NM_002608" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 5 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | c-sis; IBGC5; PDGF-2; PDGF2; SIS; SSV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206587 representing NM_002608.
Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGAATCGCTGCTGGGCGCTCTTCCTGTCTCTCTGCTGCTACCTGCGTCTGGTCAGCGCCGAGGGGGAC CCCATTCCCGAGGAGCTTTATGAGATGCTGAGTGACCACTCGATCCGCTCCTTTGATGATCTCCAACGC CTGCTGCACGGAGACCCCGGAGAGGAAGATGGGGCCGAGTTGGACCTGAACATGACCCGCTCCCACTCT GGAGGCGAGCTGGAGAGCTTGGCTCGTGGAAGAAGGAGCCTGGGTTCCCTGACCATTGCTGAGCCGGCC ATGATCGCCGAGTGCAAGACGCGCACCGAGGTGTTCGAGATCTCCCGGCGCCTCATAGACCGCACCAAC GCCAACTTCCTGGTGTGGCCGCCCTGTGTGGAGGTGCAGCGCTGCTCCGGCTGCTGCAACAACCGCAAC GTGCAGTGCCGCCCCACCCAGGTGCAGCTGCGACCTGTCCAGGTGAGAAAGATCGAGATTGTGCGGAAG AAGCCAATCTTTAAGAAGGCCACGGTGACGCTGGAAGACCACCTGGCATGCAAGTGTGAGACAGTGGCA GCTGCACGGCCTGTGACCCGAAGCCCGGGGGGTTCCCAGGAGCAGCGAGCCAAAACGCCCCAAACTCGG GTGACCATTCGGACGGTGCGAGTCCGCCGGCCCCCCAAGGGCAAGCACCGGAAATTCAAGCACACGCAT GACAAGACGGCACTGAAGGAGACCCTTGGAGCC AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT ATCCTGGATTACAAGGATGACGACGATAAGGTTTAA >Peptide sequence encoded by RC206587
Blue=ORF Red=Cloning site Green=Tag(s) MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHS GGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRN VQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTR VTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-RsrII Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002608 |
ORF Size | 723 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_002608.4 |
RefSeq Size | 3393 bp |
RefSeq ORF | 726 bp |
Locus ID | 5155 |
UniProt ID | P01127 |
Domains | PDGF, PDGF_N |
Protein Families | Druggable Genome |
Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma |
MW | 27.3 kDa |
Gene Summary | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Citations (5)
The use of this cDNA Clones has been cited in the following citations: |
---|
Analysis of gene expression and functional characterization of XPR1: a pathogenic gene for primary familial brain calcification
,Yao, XP;Zhao, M;Wang, C;Guo, XX;Su, HZ;Dong, EL;Chen, HT;Lai, JH;Liu, YB;Wang, N;Chen, WJ;,
Cell Tissue Res.
,PubMed ID 28766044
[PDGF beta]
|
Effect of sustained PDGF nonviral gene delivery on repair of tooth-supporting bone defects
,Plonka, AB;Khorsand, B;Yu, N;Sugai, JV;Salem, AK;Giannobile, WV;Elangovan, S;,
Gene Ther.
,PubMed ID 27824330
[PDGF beta]
|
Integration of Growth Factor Gene Delivery with Collagen-Triggered Wound Repair Cascades using Collagen-Mimetic Peptides
,Urello, MA;Kiick, KL;Sullivan, MO;,
Bioengineering & Translational Medicine
,PubMed ID 27981245
[PDGF beta]
|
Natural polymer based gene activated matrices for bone regeneration
,D'mello, SR;,
Thesis
[PDGF beta]
|
A Pilot Study Evaluating Combinatorial and Simultaneous Delivery of Polyethylenimine-Plasmid DNA Complexes Encoding for VEGF and PDGF for Bone Regeneration in Calvarial Bone Defects
,D'Mello, SR;Elangovan, S;Hong, L;Ross, RD;Sumner, DR;Salem, AK;,
Curr Pharm Biotechnol
,PubMed ID 25934975
[PDGF beta]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206587L1 | Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC206587L2 | Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RC206587L3 | Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC206587L4 | Lenti ORF clone of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG206587 | PDGFB (tGFP-tagged) - Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1 |
CNY 4,000.00 |
|
SC111665 | PDGFB (untagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1 |
CNY 3,600.00 |
|
SC324287 | PDGFB (untagged)-Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1 |
CNY 3,600.00 |
其它PDGF beta产品