Calprotectin (S100A9) (NM_002965) Human Tagged ORF Clone
CAT#: RC208250
S100A9 (Myc-DDK-tagged)-Human S100 calcium binding protein A9 (S100A9)
ORF Plasmid: tGFP
"NM_002965" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 60B8AG; CAGB; CFAG; CGLB; L1AG; LIAG; MAC387; MIF; MRP14; NIF; P14 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC208250 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTTGCAAAATGTCGCAGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCACCAATACTCTG TGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTGGTGCGAAAAGATCTGCAAAA TTTTCTCAAGAAGGAGAATAAGAATGAAAAGGTCATAGAACACATCATGGAGGACCTGGACACAAATGCA GACAAGCAGCTGAGCTTCGAGGAGTTCATCATGCTGATGGCGAGGCTAACCTGGGCCTCCCACGAGAAGA TGCACGAGGGTGACGAGGGCCCTGGCCACCACCATAAGCCAGGCCTCGGGGAGGGCACCCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC208250 protein sequence
Red=Cloning site Green=Tags(s) MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002965 |
ORF Size | 342 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002965.4 |
RefSeq Size | 586 bp |
RefSeq ORF | 345 bp |
Locus ID | 6280 |
UniProt ID | P06702 |
Domains | S_100, EFh |
MW | 13.2 kDa |
Gene Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Upregulation of S100A9 contributes to the acquired resistance to BRAF inhibitors
,Hwang, SH;Ahn, JH;Lee, M;,
Genes Genomics
,PubMed ID 31388978
[S100A9]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC208250L1 | Lenti ORF clone of Human S100 calcium binding protein A9 (S100A9), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC208250L2 | Lenti ORF clone of Human S100 calcium binding protein A9 (S100A9), mGFP tagged |
CNY 3,600.00 |
|
RC208250L3 | Lenti ORF clone of Human S100 calcium binding protein A9 (S100A9), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC208250L4 | Lenti ORF clone of Human S100 calcium binding protein A9 (S100A9), mGFP tagged |
CNY 3,600.00 |
|
RG208250 | S100A9 (tGFP-tagged) - Human S100 calcium binding protein A9 (S100A9) |
CNY 2,800.00 |
|
SC111010 | S100A9 (untagged)-Human S100 calcium binding protein A9 (S100A9) |
CNY 1,200.00 |