GSTM5 (NM_000851) Human Tagged ORF Clone
CAT#: RC208900
GSTM5 (Myc-DDK-tagged)-Human glutathione S-transferase mu 5 (GSTM5)
ORF Plasmid: tGFP
"NM_000851" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GSTM5-5; GTM5 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC208900 representing NM_000851
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCATGACTCTGGGGTACTGGGACATCCGTGGGCTGGCCCACGCCATCCGCTTGCTCCTGGAATACA CAGACTCAAGCTATGTGGAAAAGAAGTACACGCTGGGGGACGCTCCTGACTATGACAGAAGCCAGTGGCT GAATGAAAAATTCAAGCTGGGCCTGGACTTTCCCAATCTGCCCTACTTGATTGATGGGACTCACAAGATC ACCCAGAGCAATGCCATCCTGCGCTACATTGCCCGCAAGCACAACCTGTGTGGGGAGACAGAAGAGGAGA AGATTCGTGTGGACATTTTGGAGAACCAGGTTATGGATAACCACATGGAGCTGGTCAGACTGTGCTATGA CCCAGATTTTGAGAAACTGAAGCCAAAATACTTGGAGGAACTCCCTGAAAAGCTAAAGCTCTACTCAGAG TTTCTGGGGAAGCGGCCATGGTTTGCAGGAGACAAGATCACCTTTGTGGATTTCCTTGCCTATGATGTCC TTGACATGAAGCGTATATTTGAGCCCAAGTGCTTGGACGCCTTCCTAAACTTGAAGGACTTCATCTCCCG CTTTGAGGGTTTGAAGAAGATCTCTGCCTACATGAAGTCCAGCCAATTCCTCCGAGGTCTTTTGTTTGGA AAGTCAGCTACATGGAACAGCAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC208900 representing NM_000851
Red=Cloning site Green=Tags(s) MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKI TQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSE FLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFG KSATWNSK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000851 |
ORF Size | 654 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_000851.4 |
RefSeq Size | 1567 bp |
RefSeq ORF | 657 bp |
Locus ID | 2949 |
UniProt ID | P46439 |
Domains | GST_N, GST_C |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
MW | 25.5 kDa |
Gene Summary | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Anti-Cancer Effects and Tumor Marker Role of Glutathione S -Transferase Mu 5 in Human Bladder Cancer
,null,
International Journal of Molecular Sciences
,PubMed ID 33802702
[GSTM5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC208900L3 | Lenti ORF clone of Human glutathione S-transferase mu 5 (GSTM5), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC208900L4 | Lenti ORF clone of Human glutathione S-transferase mu 5 (GSTM5), mGFP tagged |
CNY 5,890.00 |
|
RG208900 | GSTM5 (tGFP-tagged) - Human glutathione S-transferase mu 5 (GSTM5) |
CNY 4,370.00 |
|
SC310618 | GSTM5 (untagged)-Human glutathione S-transferase mu 5 (GSTM5) |
CNY 3,990.00 |