SOX22 (SOX12) (NM_006943) Human Tagged ORF Clone

CAT#: RC209114

  • TrueORF®

SOX12 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 12 (SOX12)

ORF Plasmid: DDK tGFP



  "NM_006943" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit polyclonal anti-SOX12 antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms SOX22
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209114 representing NM_006943
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCAGCAGCGGGGCGCGAGGGCCAAGCGGGACGGCGGGCCGCCGCCCCCGGGACCCGGGCCGGCCG
AGGAGGGGGCGCGCGAGCCCGGCTGGTGCAAGACCCCGAGCGGCCACATCAAGAGGCCGATGAACGCATT
CATGGTGTGGTCGCAGCACGAACGGCGGAAGATCATGGACCAGTGGCCCGACATGCACAACGCCGAGATC
TCCAAGCGCCTGGGCCGCCGCTGGCAGCTGCTGCAGGACTCGGAGAAGATCCCGTTCGTGCGGGAGGCGG
AGCGGCTGCGGCTCAAGCACATGGCGGATTACCCGGACTACAAGTACCGGCCGCGCAAAAAGAGCAAGGG
GGCGCCCGCCAAGGCGCGGCCCCGCCCCCCCGGTGGTAGCGGTGGCGGCAGCCGGCTCAAGCCCGGGCCG
CAGCTGCCTGGCCGCGGGGGCCGCCGAGCAGCGGGAGGGCCTTTGGGGGGCGGGGCGGCGGCGCCCGAGG
ACGACGATGAAGACGACGACGAGGAGCTGCTGGAAGTGCGCCTGGTCGAGACCCCGGGGCGGGAGCTGTG
GAGGATGGTCCCGGCGGGACGGGCCGCTCGGGGACAAGCGGAGCGCGCCCAAGGGCCGTCGGGCGAGGGG
GCGGCCGCCGCCGCCGCCGCCTCCCCGACACCGTCGGAGGACGAGGAGCCGGAGGAAGAGGAGGAGGAGG
CGGCAGCGGCTGAGGAAGGTGAAGAGGAGACGGTGGCGTCGGGGGAGGAGTCGCTGGGCTTTCTGTCCAG
GCTGCCCCCTGGCCCGGCCGGCCTGGACTGCAGCGCCCTGGATCGCGACCCGGACCTGCAGCCTCCCTCG
GGCACGTCGCACTTCGAGTTCCCGGACTACTGCACCCCCGAGGTTACCGAGATGATCGCGGGGGACTGGC
GCCCGTCTAGCATCGCAGACCTGGTTTTCACCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209114 representing NM_006943
Red=Cloning site Green=Tags(s)

MVQQRGARAKRDGGPPPPGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEI
SKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGP
QLPGRGGRRAAGGPLGGGAAAPEDDDEDDDEELLEVRLVETPGRELWRMVPAGRAARGQAERAQGPSGEG
AAAAAAASPTPSEDEEPEEEEEEAAAAEEGEEETVASGEESLGFLSRLPPGPAGLDCSALDRDPDLQPPS
GTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006943
ORF Size 945 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006943.3
RefSeq Size 4645 bp
RefSeq ORF 948 bp
Locus ID 6666
UniProt ID O15370
Protein Families ES Cell Differentiation/IPS, Transcription Factors
MW 33.9 kDa
Gene Summary Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains, and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq, Jan 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...