MSC (NM_005098) Human Tagged ORF Clone

CAT#: RC209818

MSC (Myc-DDK-tagged)-Human musculin (MSC)

ORF Plasmid: DDK tGFP



  "NM_005098" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit polyclonal anti-Musculin antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms ABF-1; ABF1; bHLHa22; MYOR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209818 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACGGGCTCGGTGAGTGATCCGGAGGAGATGGAGCTTCGGGGGCTGCAGCGGGAGTACCCGGTCC
CCGCCTCCAAGAGGCCGCCCCTCCGCGGCGTAGAGCGCAGCTACGCCTCGCCCAGTGACAACTCGTCGGC
AGAGGAGGAGGACCCCGACGGCGAGGAGGAGCGCTGCGCTCTGGGCACAGCCGGCAGCGCGGAAGGCTGC
AAGAGGAAGCGGCCCCGTGTGGCTGGGGGCGGCGGCGCAGGTGGTAGCGCGGGCGGTGGTGGCAAGAAGC
CCCTCCCGGCCAAGGGCTCAGCCGCAGAGTGCAAGCAGTCGCAGCGGAACGCGGCCAACGCCCGTGAGCG
TGCCCGGATGCGCGTGCTGAGCAAAGCCTTCTCCAGGCTCAAGACCAGCCTGCCCTGGGTGCCCCCCGAC
ACTAAGCTCTCCAAGCTGGACACGCTCCGGCTGGCTTCCAGTTACATCGCTCACCTGCGGCAGCTGTTGC
AGGAGGACCGCTATGAGAACGGCTACGTGCACCCAGTGAACCTGACATGGCCATTCGTGGTCTCGGGAAG
ACCGGACTCTGACACCAAAGAAGTTTCCGCAGCCAACAGACTATGTGGAACCACCGCT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC209818 protein sequence
Red=Cloning site Green=Tags(s)

MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC
KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD
TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005098
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005098.3, NP_005089.2
RefSeq Size 2075 bp
RefSeq ORF 621 bp
Locus ID 9242
UniProt ID O60682
Protein Families Druggable Genome, Transcription Factors
MW 22.1 kDa
Gene Summary The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...