PTP4A2 (NM_080391) Human Tagged ORF Clone
CAT#: RC209983
PTP4A2 (Myc-DDK-tagged)-Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1
ORF Plasmid: tGFP
"NM_080391" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209983 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACCGTCCAGCCCCTGTGGAGATCTCCTATGAGAACATGCGTTTTCTGATAACTCACAACCCTACCA ATGCTACTCTCAACAAGTTCACAGAGGAACTTAAGAAGTATGGAGTGACGACTTTGGTTCGAGTTTGTGA TGCTACATATGATAAAGCTCCAGTTGAAAAAGAAGGAATCCACGTTCTAGATTGGCCATTTGATGATGGA GCTCCACCCCCTAATCAGATAGTAGATGATTGGTTAAACCTGTTAAAAACCAAATTTCGTGAAGAGCCAG GTTGCTGTGTTGCAGTGCATTGTGTTGCAGGATTGGGAAGGGCACCTGTGCTGGTTGCACTTGCTTTGAT TGAATGTGGAATGAAGTACGAAGATGCAGTTCAGTTTATAAGACAAAAAAGAAGGGGAGCGTTCAATTCC AAACAGCTGCTTTATTTGGAGAAATACCGACCTAAGATGCGATTACGCTTCAGAGATACCAATGGGCATT GCTGTGTTCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209983 protein sequence
Red=Cloning site Green=Tags(s) MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS KQLLYLEKYRPKMRLRFRDTNGHCCVQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_080391 |
ORF Size | 501 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_080391.4 |
RefSeq Size | 3939 bp |
RefSeq ORF | 504 bp |
Locus ID | 8073 |
UniProt ID | Q12974 |
Domains | Y_phosphatase, PTPc_motif |
Protein Families | Druggable Genome, Phosphatase |
MW | 19.1 kDa |
Gene Summary | The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. [provided by RefSeq, Aug 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209983L1 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC209983L2 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC209983L3 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC209983L4 | Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG209983 | PTP4A2 (tGFP-tagged) - Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 |
CNY 4,000.00 |
|
SC109921 | PTP4A2 (untagged)-Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 |
CNY 2,400.00 |