Cyclin D2 (CCND2) (NM_001759) Human Tagged ORF Clone
CAT#: RC210316
CCND2 (Myc-DDK-tagged)-Human cyclin D2 (CCND2)
ORF Plasmid: tGFP
"NM_001759" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
Cited in 2 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | KIAK0002; MPPH3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210316 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGCTGCTGTGCCACGAGGTGGACCCGGTCCGCAGGGCCGTGCGGGACCGCAACCTGCTCCGAGACG ACCGCGTCCTGCAGAACCTGCTCACCATCGAGGAGCGCTACCTTCCGCAGTGCTCCTACTTCAAGTGCGT GCAGAAGGACATCCAACCCTACATGCGCAGAATGGTGGCCACCTGGATGCTGGAGGTCTGTGAGGAACAG AAGTGCGAAGAAGAGGTCTTCCCTCTGGCCATGAATTACCTGGACCGTTTCTTGGCTGGGGTCCCGACTC CGAAGTCCCATCTGCAACTCCTGGGTGCTGTCTGCATGTTCCTGGCCTCCAAACTCAAAGAGACCAGCCC GCTGACCGCGGAGAAGCTGTGCATTTACACCGACAACTCCATCAAGCCTCAGGAGCTGCTGGAGTGGGAA CTGGTGGTGCTGGGGAAGTTGAAGTGGAACCTGGCAGCTGTCACTCCTCATGACTTCATTGAGCACATCT TGCGCAAGCTGCCCCAGCAGCGGGAGAAGCTGTCTCTGATCCGCAAGCATGCTCAGACCTTCATTGCTCT GTGTGCCACCGACTTTAAGTTTGCCATGTACCCACCGTCGATGATCGCAACTGGAAGTGTGGGAGCAGCC ATCTGTGGGCTCCAGCAGGATGAGGAAGTGAGCTCGCTCACTTGTGATGCCCTGACTGAGCTGCTGGCTA AGATCACCAACACAGACGTGGATTGTCTCAAAGCTTGCCAGGAGCAGATTGAGGCGGTGCTCCTCAATAG CCTGCAGCAGTACCGTCAGGACCAACGTGACGGATCCAAGTCGGAGGATGAACTGGACCAAGCCAGCACC CCTACAGACGTGCGGGATATCGACCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210316 protein sequence
Red=Cloning site Green=Tags(s) MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQ KCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWE LVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAA ICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQAST PTDVRDIDL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001759 |
ORF Size | 867 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001759.4 |
RefSeq Size | 6531 bp |
RefSeq ORF | 870 bp |
Locus ID | 894 |
UniProt ID | P30279 |
Domains | cyclin_C, CYCLIN, cyclin |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Focal adhesion, Jak-STAT signaling pathway, p53 signaling pathway, Wnt signaling pathway |
MW | 33.1 kDa |
Gene Summary | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). [provided by RefSeq, Sep 2014] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
The genomic landscape of core-binding factor acute myeloid leukemias
,Faber, ZJ;Chen, X;Gedman, AL;Boggs, K;Cheng, J;Ma, J;Radtke, I;Chao, JR;Walsh, MP;Song, G;Andersson, AK;Dang, J;Dong, L;Liu, Y;Huether, R;Cai, Z;Mulder, H;Wu, G;Edmonson, M;Rusch, M;Qu, C;Li, Y;Vadodaria, B;Wang, J;Hedlund, E;Cao, X;Yergeau, D;Nakitandwe, J;Pounds, SB;Shurtleff, S;Fulton, RS;Fulton, LL;Easton, J;Parganas, E;Pui, CH;Rubnitz, JE;Ding, L;Mardis, ER;Wilson, RK;Gruber, TA;Mullighan, CG;Schlenk, RF;Paschka, P;Döhner, K;Döhner, H;Bullinger, L;Zhang, J;Klco, JM;Downing, JR;,
Nat. Genet.
,PubMed ID 27798625
[Cyclin D2]
|
De novo CCND2 mutations leading to stabilization of cyclin D2 cause megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome
,Mirzaa, GM;Parry, DA;Fry, AE;Giamanco, KA;Schwartzentruber, J;Vanstone, M;Logan, CV;Roberts, N;Johnson, CA;Singh, S;Kholmanskikh, SS;Adams, C;Hodge, RD;Hevner, RF;Bonthron, DT;Braun, KP;Faivre, L;Rivière, JB;St-Onge, J;Gripp, KW;Mancini, GM;Pang, K;Sweeney, E;van Esch, H;Verbeek, N;Wieczorek, D;Steinraths, M;Majewski, J;FORGE Canada Consortium, ;Boycott, KM;Pilz, DT;Ross, ME;Dobyns, WB;Sheridan, EG;,
Nat. Genet. 510-5 46 5. May 2014
,PubMed ID 24705253
[Cyclin D2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210316L1 | Lenti ORF clone of Human cyclin D2 (CCND2), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC210316L2 | Lenti ORF clone of Human cyclin D2 (CCND2), mGFP tagged |
CNY 6,000.00 |
|
RC210316L3 | Lenti ORF clone of Human cyclin D2 (CCND2), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC210316L4 | Lenti ORF clone of Human cyclin D2 (CCND2), mGFP tagged |
CNY 6,000.00 |
|
RG210316 | CCND2 (tGFP-tagged) - Human cyclin D2 (CCND2) |
CNY 5,200.00 |
|
SC119036 | CCND2 (untagged)-Human cyclin D2 (CCND2) |
CNY 2,400.00 |
其它Cyclin D2产品