BAD (NM_032989) Human Tagged ORF Clone
CAT#: RC210630
BAD (Myc-DDK-tagged)-Human BCL2-associated agonist of cell death (BAD), transcript variant 2
ORF Plasmid: tGFP
"NM_032989" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BBC2; BCL2L8 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210630 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTCCAGATCCCAGAGTTTGAGCCGAGTGAGCAGGAAGACTCCAGCTCTGCAGAGAGGGGCCTGGGCC CCAGCCCCGCAGGGGACGGGCCCTCAGGCTCCGGCAAGCATCATCGCCAGGCCCCAGGCCTCCTGTGGGA CGCCAGTCACCAGCAGGAGCAGCCAACCAGCAGCAGCCATCATGGAGGCGCTGGGGCTGTGGAGATCCGG AGTCGCCACAGCTCCTACCCCGCGGGGACGGAGGACGACGAAGGGATGGGGGAGGAGCCCAGCCCCTTTC GGGGCCGCTCGCGCTCGGCGCCCCCCAACCTCTGGGCAGCACAGCGCTATGGCCGCGAGCTCCGGAGGAT GAGTGACGAGTTTGTGGACTCCTTTAAGAAGGGACTTCCTCGCCCGAAGAGCGCGGGCACAGCAACGCAG ATGCGGCAAAGCTCCAGCTGGACGCGAGTCTTCCAGTCCTGGTGGGATCGGAACTTGGGCAGGGGAAGCT CCGCCCCCTCCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210630 protein sequence
Red=Cloning site Green=Tags(s) MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ MRQSSSWTRVFQSWWDRNLGRGSSAPSQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032989 |
ORF Size | 504 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_032989.3 |
RefSeq Size | 986 bp |
RefSeq ORF | 507 bp |
Locus ID | 572 |
UniProt ID | Q92934 |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway |
MW | 18.4 kDa |
Gene Summary | The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Dec 2019] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210630L1 | Lenti ORF clone of Human BCL2-associated agonist of cell death (BAD), transcript variant 2, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC210630L2 | Lenti ORF clone of Human BCL2-associated agonist of cell death (BAD), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC210630L3 | Lenti ORF clone of Human BCL2-associated agonist of cell death (BAD), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210630L4 | Lenti ORF clone of Human BCL2-associated agonist of cell death (BAD), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG210630 | BAD (tGFP-tagged) - Human BCL2-associated agonist of cell death (BAD), transcript variant 2 |
CNY 4,000.00 |
|
SC108970 | BAD (untagged)-Human BCL2-associated agonist of cell death (BAD), transcript variant 2 |
CNY 2,400.00 |