United States
Germany
Japan
United Kingdom
China
Cystatin C (CST3) (NM_000099) Human Tagged ORF Clone
CAT＃: RC210730
CST3 (Myc-DDK-tagged)-Human cystatin C (CST3)
ORF Plasmid: tGFP
"NM_000099" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 3 publications. |
Product images
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | ARMD11; HEL-S-2 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC210730 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGGGCCCCTGCGCGCCCCGCTGCTCCTGCTGGCCATCCTGGCCGTGGCCCTGGCCGTGAGCCCCG CGGCCGGCTCCAGTCCCGGCAAGCCGCCGCGCCTGGTGGGAGGCCCCATGGACGCCAGCGTGGAGGAGGA GGGTGTGCGGCGTGCACTGGACTTTGCCGTCGGCGAGTACAACAAAGCCAGCAACGACATGTACCACAGC CGCGCGCTGCAGGTGGTGCGCGCCCGCAAGCAGATCGTAGCTGGGGTGAACTACTTCTTGGACGTGGAGC TGGGCCGAACCACGTGTACCAAGACCCAGCCCAACTTGGACAACTGCCCCTTCCATGACCAGCCACATCT GAAAAGGAAAGCATTCTGCTCTTTCCAGATCTACGCTGTGCCTTGGCAGGGCACAATGACCTTGTCGAAA TCCACCTGTCAGGACGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210730 protein sequence
Red=Cloning site Green=Tags(s) MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK STCQDA myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_000099 |
| ORF Size | 438 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_000099.3 |
| RefSeq Size | 929 bp |
| RefSeq ORF | 441 bp |
| Locus ID | 1471 |
| UniProt ID | P01034 |
| Domains | CY |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| MW | 15.8 kDa |
| Gene Summary | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. In addition, this protein has been shown to have an antimicrobial function, inhibiting the replication of herpes simplex virus. Alternative splicing results in multiple transcript variants encoding a single protein. [provided by RefSeq, Nov 2014] |
Citations (3)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Cystatin C promotes tau protein phosphorylation and causes microtubule instability by inhibiting intracellular turnover of GSK3β in neurons
,Duan, J;Marcellus, KA;Qin, X;Wang, Y;Paudel, HK;,
Mol. Cell. Neurosci.
,PubMed ID 29577984
[Cystatin C]
|
|
Differential cathepsin responses to inhibitor-induced feedback: E-64 and cystatin C elevate active cathepsin S and suppress active cathepsin L in breast cancer cells
,Wilder, CL;Walton, C;Watson, V;Stewart, FA;Johnson, J;Peyton, SR;Payne, CK;Odero-Marah, V;Platt, MO;,
Int. J. Biochem. Cell Biol.
,PubMed ID 27592448
[cystatin C]
|
|
Identification of Cystatin SA as a Novel Inhibitor of Acid Ceramidase
,Efrat Eliyahu, Nataly Shtraizent, Xingxuan He, Dafna Chen, Ruth Shalgi, and Edward H. Schuchman,
J. Biol. Chem., Oct 2011; 286: 35624 - 35633.
[Cystatin C]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC210730L1 | Lenti ORF clone of Human cystatin C (CST3), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC210730L2 | Lenti ORF clone of Human cystatin C (CST3), mGFP tagged |
CNY 3,600.00 |
|
| RC210730L3 | Lenti ORF clone of Human cystatin C (CST3), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC210730L4 | Lenti ORF clone of Human cystatin C (CST3), mGFP tagged |
CNY 3,600.00 |
|
| RG210730 | CST3 (tGFP-tagged) - Human cystatin C (CST3) |
CNY 2,800.00 |
|
| SC110862 | CST3 (untagged)-Human cystatin C (CST3) |
CNY 1,200.00 |
其它Cystatin C产品
