CTLA4 (NM_001037631) Human Tagged ORF Clone
CAT#: RC213631
CTLA4 (Myc-DDK-tagged)-Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2
ORF Plasmid: tGFP
"NM_001037631" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ALPS5; CD; CD152; CELIAC3; CTLA-4; GRD4; GSE; IDDM12 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213631 representing NM_001037631
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTTGCCTTGGATTTCAGCGGCACAAGGCTCAGCTGAACCTGGCTACCAGGACCTGGCCCTGCACTC TCCTGTTTTTTCTTCTCTTCATCCCTGTCTTCTGCAAAGCAATGCACGTGGCCCAGCCTGCTGTGGTACT GGCCAGCAGCCGAGGCATCGCCAGCTTTGTGTGTGAGTATGCATCTCCAGGCAAAGCCACTGAGGTCCGG GTGACAGTGCTTCGGCAGGCTGACAGCCAGGTGACTGAAGTCTGTGCGGCAACCTACATGATGGGGAATG AGTTGACCTTCCTAGATGATTCCATCTGCACGGGCACCTCCAGTGGAAATCAAGTGAACCTCACTATCCA AGGACTGAGGGCCATGGACACGGGACTCTACATCTGCAAGGTGGAGCTCATGTACCCACCGCCATACTAC CTGGGCATAGGCAACGGAACCCAGATTTATGTAATTGCTAAAGAAAAGAAGCCCTCTTACAACAGGGGTC TATGTGAAAATGCCCCCAACAGAGCCAGAATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213631 representing NM_001037631
Red=Cloning site Green=Tags(s) MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVR VTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYY LGIGNGTQIYVIAKEKKPSYNRGLCENAPNRARM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001037631 |
ORF Size | 522 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001037631.3 |
RefSeq Size | 1878 bp |
RefSeq ORF | 525 bp |
Locus ID | 1493 |
UniProt ID | P16410 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Autoimmune thyroid disease, Cell adhesion molecules (CAMs), T cell receptor signaling pathway |
MW | 19.15 kDa |
Gene Summary | This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Interferon-γ Signaling in Melanocytes and Melanoma Cells Regulates Expression of CTLA-4
,Mo, X;Zhang, H;Preston, S;Martin, K;Zhou, B;Vadalia, N;Gamero, AM;Soboloff, J;Tempera, I;Zaidi, MR;,
Cancer Res.
,PubMed ID 29150430
[CTLA4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213631L1 | Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC213631L2 | Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, mGFP tagged |
CNY 6,000.00 |
|
RC213631L3 | Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC213631L4 | Lenti ORF clone of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2, mGFP tagged |
CNY 6,000.00 |
|
RG213631 | CTLA4 (tGFP-tagged) - Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2 |
CNY 5,200.00 |
|
SC302916 | CTLA4 (untagged)-Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 2 |
CNY 2,400.00 |