FGF8 (NM_006119) Human Tagged ORF Clone
CAT#: RC214620
- TrueORF®
FGF8 (Myc-DDK-tagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B
ORF Plasmid: tGFP
"NM_006119" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AIGF; FGF-8; HBGF-8; HH6; KAL6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC214620 representing NM_006119
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCAGCCCCCGCTCCGCGCTGAGCTGCCTGCTGTTGCACTTGCTGGTCCTCTGCCTCCAAGCCCAGG TAACTGTTCAGTCCTCACCTAATTTTACACAGCATGTGAGGGAGCAGAGCCTGGTGACGGATCAGCTCAG CCGCCGCCTCATCCGGACCTACCAACTCTACAGCCGCACCAGCGGGAAGCACGTGCAGGTCCTGGCCAAC AAGCGCATCAACGCCATGGCAGAGGACGGCGACCCCTTCGCAAAGCTCATCGTGGAGACGGACACCTTTG GAAGCAGAGTTCGAGTCCGAGGAGCCGAGACGGGCCTCTACATCTGCATGAACAAGAAGGGGAAGCTGAT CGCCAAGAGCAACGGCAAAGGCAAGGACTGCGTCTTCACGGAGATTGTGCTGGAGAACAACTACACAGCG CTGCAGAATGCCAAGTACGAGGGCTGGTACATGGCCTTCACCCGCAAGGGCCGGCCCCGCAAGGGCTCCA AGACGCGGCAGCACCAGCGTGAGGTCCACTTCATGAAGCGGCTGCCCCGGGGCCACCACACCACCGAGCA GAGCCTGCGCTTCGAGTTCCTCAACTACCCGCCCTTCACGCGCAGCCTGCGCGGCAGCCAGAGGACTTGG GCCCCCGAGCCCCGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC214620 representing NM_006119
Red=Cloning site Green=Tags(s) MGSPRSALSCLLLHLLVLCLQAQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLAN KRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTA LQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTW APEPR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006119 |
ORF Size | 645 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006119.6 |
RefSeq Size | 1020 bp |
RefSeq ORF | 648 bp |
Locus ID | 2253 |
UniProt ID | P55075 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
MW | 24.71 kDa |
Gene Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Fibroblast growth factor induced Ucp1 expression in preadipocytes requires PGE2 biosynthesis and glycolytic flux
,Gantert, T;Henkel, F;Wurmser, C;Oeckl, J;Fischer, L;Haid, M;Adamski, J;Esser-von Bieren, J;Klingenspor, M;Fromme, T;,
FASEB journal : official publication of the Federation of American Societies for Experimental Biology
,PubMed ID 33826782
[FGF8]
|
Sources of umami taste in Cheddar and Swiss cheeses.
,null,
Journal of food science
,PubMed ID 17995691
[FGF8]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC214620L1 | Lenti-ORF clone of FGF8 (Myc-DDK-tagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B |
CNY 6,000.00 |
|
RC214620L2 | Lenti-ORF clone of FGF8 (mGFP-tagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B |
CNY 6,000.00 |
|
RC214620L3 | Lenti-ORF clone of FGF8 (Myc-DDK-tagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B |
CNY 5,890.00 |
|
RC214620L4 | Lenti-ORF clone of FGF8 (mGFP-tagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B |
CNY 5,890.00 |
|
RG214620 | FGF8 (tGFP-tagged) - Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B |
CNY 4,370.00 |
|
SC303734 | FGF8 (untagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B |
CNY 3,600.00 |