United States
Germany
Japan
United Kingdom
China
IL10 (NM_000572) Human Tagged ORF Clone
CAT＃: RC216785
IL10 (Myc-DDK-tagged)-Human interleukin 10 (IL10)
ORF Plasmid: tGFP
"NM_000572" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
| Cited in 3 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | CSIF; GVHDS; IL-10; IL10A; TGIF |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC216785 representing NM_000572
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAGGGCCAGCCCAGGCCAGGGCA CCCAGTCTGAGAACAGCTGCACCCACTTCCCAGGCAACCTGCCTAACATGCTTCGAGATCTCCGAGATGC CTTCAGCAGAGTGAAGACTTTCTTTCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAAGGAGTCCTTG CTGGAGGACTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCTGAGATGATCCAGTTTTACCTGGAGGAGG TGATGCCCCAAGCTGAGAACCAAGACCCAGACATCAAGGCGCATGTGAACTCCCTGGGGGAGAACCTGAA GACCCTCAGGCTGAGGCTACGGCGCTGTCATCGATTTCTTCCCTGTGAAAACAAGAGCAAGGCCGTGGAG CAGGTGAAGAATGCCTTTAATAAGCTCCAAGAGAAAGGCATCTACAAAGCCATGAGTGAGTTTGACATCT TCATCAACTACATAGAAGCCTACATGACAATGAAGATACGAAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC216785 representing NM_000572
Red=Cloning site Green=Tags(s) MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESL LEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVE QVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_000572 |
| ORF Size | 534 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_000572.3 |
| RefSeq Size | 1629 bp |
| RefSeq ORF | 537 bp |
| Locus ID | 3586 |
| UniProt ID | P22301 |
| Domains | IL10 |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Allograft rejection, Asthma, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Systemic lupus erythematosus, T cell receptor signaling pathway |
| MW | 20.52 kDa |
| Gene Summary | The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. [provided by RefSeq, May 2020] |
Citations (3)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
IL‑10 secreted by cancer‑associated macrophages regulates proliferation and invasion in gastric cancer cells via c‑Met/STAT3 signaling
,Chen, L;Shi, Y;Zhu, X;Guo, W;Zhang, M;Che, Y;Tang, L;Yang, X;You, Q;Liu, Z;,
Oncol. Rep.
,PubMed ID 31233202
[IL10]
|
|
Long Interleukin-22 Binding Protein Isoform-1 Is an Intracellular Activator of the Unfolded Protein Response
,Gómez-Fernández, P;Urtasun, A;Paton, AW;Paton, JC;Borrego, F;Dersh, D;Argon, Y;Alloza, I;Vandenbroeck, K;,
Front Immunol
,PubMed ID 30619294
[IL10]
|
|
IL-10 secreted by M2 macrophage promoted tumorigenesis through interaction with JAK2 in glioma
,Qi, L;Yu, H;Zhang, Y;Zhao, D;Lv, P;Zhong, Y;Xu, Y;,
Oncotarget
,PubMed ID 27765933
[IL10]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC216785L1 | Lenti ORF clone of Human interleukin 10 (IL10), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC216785L2 | Lenti ORF clone of Human interleukin 10 (IL10), mGFP tagged |
CNY 6,000.00 |
|
| RC216785L3 | Lenti ORF clone of Human interleukin 10 (IL10), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC216785L4 | Lenti ORF clone of Human interleukin 10 (IL10), mGFP tagged |
CNY 6,000.00 |
|
| RG216785 | IL10 (tGFP-tagged) - Human interleukin 10 (IL10) |
CNY 5,200.00 |
|
| SC300099 | IL10 (untagged)-Human interleukin 10 (IL10) |
CNY 2,400.00 |
