CPSF30 (CPSF4) (NM_006693) Human Tagged ORF Clone

CAT#: RC217281

CPSF4 (Myc-DDK-tagged)-Human cleavage and polyadenylation specific factor 4, 30kDa (CPSF4), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_006693" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal Anti-CPSF4 Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CPSF30; NAR; NEB-1; NEB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217281 representing NM_006693
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGAAATCATCGCCAGCGTGGACCACATCAAGTTTGACTTGGAGATCGCGGTGGAGCAGCAGCTGG
GGGCGCAGCCGCTGCCCTTCCCCGGCATGGACAAGTCGGGCGCTGCTGTCTGTGAATTCTTTTTGAAAGC
TGCCTGCGGCAAAGGGGGCATGTGTCCGTTTCGCCACATCAGTGGTGAGAAGACAGTTGTGTGCAAACAC
TGGCTGCGTGGCCTATGCAAGAAAGGGGACCAGTGTGAGTTCCTGCATGAGTATGACATGACCAAGATGC
CCGAGTGCTACTTCTACTCCAAGTTCGGGGAGTGCAGCAACAAGGAATGTCCCTTCCTGCACATCGACCC
CGAGTCCAAGATCAAGGACTGTCCTTGGTATGACCGCGGCTTCTGCAAGCACGGTCCCCTCTGCAGGCAC
CGGCACACACGGAGAGTCATCTGTGTGAATTACCTCGTGGGATTCTGCCCGGAGGGGCCCTCGTGTAAAT
TCATGCACCCTCGATTTGAACTGCCCATGGGAACCACCGAGCAGCCCCCACTGCCACAGCAGACACAGCC
TCCAGCAAAGCAAAGTAACAATCCGCCATTACAAAGGTCGTCCTCCTTGATCCAGTTAACGAGTCAGAAC
TCTTCTCCCAATCAGCAGAGAACCCCGCAGGTCATCGGGGTCATGCAGAGTCAAAACAGCAGCGCGGGCA
ACCGGGGACCCCGGCCACTGGAGCAGGTCACCTGTTACAAGTGTGGCGAGAAAGGACACTACGCCAACAG
ATGCACCAAAGGGCACTTGGCCTTTCTCAGTGGACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217281 representing NM_006693
Red=Cloning site Green=Tags(s)

MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKH
WLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRH
RHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQN
SSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006693
ORF Size 807 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006693.1, NP_006684.1
RefSeq Size 1717 bp
RefSeq ORF 810 bp
Locus ID 10898
UniProt ID O95639
Domains zf-CCCH, zf-CCHC
MW 30.1 kDa
Gene Summary Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. Multiple alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...