CMTM1 (NM_181296) Human Tagged ORF Clone
CAT#: RC219768
- TrueORF®
CMTM1 (Myc-DDK-tagged)-Human CKLF-like MARVEL transmembrane domain containing 1 (CMTM1), transcript variant 16
ORF Plasmid: tGFP
"NM_181296" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CKLFH; CKLFH1; CKLFSF1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC219768 representing NM_181296
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATCCTGAACACGCCAAACCTGAGTCATCCGAGGCACCTTCAGGGAACTTGAAACAACCGGAGACTG CCGCAGCCCTGCGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC219768 representing NM_181296
Red=Cloning site Green=Tags(s) MDPEHAKPESSEAPSGNLKQPETAAALR myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_181296 |
ORF Size | 84 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_181296.3 |
RefSeq Size | 512 bp |
RefSeq ORF | 87 bp |
Locus ID | 113540 |
UniProt ID | Q8IZ96 |
Protein Families | Transmembrane |
MW | 3 kDa |
Gene Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).[provided by RefSeq, Feb 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC219768L3 | Lenti-ORF clone of CMTM1 (Myc-DDK-tagged)-Human CKLF-like MARVEL transmembrane domain containing 1 (CMTM1), transcript variant 16 |
CNY 5,890.00 |
|
RC219768L4 | Lenti-ORF clone of CMTM1 (mGFP-tagged)-Human CKLF-like MARVEL transmembrane domain containing 1 (CMTM1), transcript variant 16 |
CNY 5,890.00 |
|
RG219768 | CMTM1 (tGFP-tagged) - Human CKLF-like MARVEL transmembrane domain containing 1 (CMTM1), transcript variant 16 |
CNY 4,370.00 |
|
SC307262 | CMTM1 (untagged)-Human CKLF-like MARVEL transmembrane domain containing 1 (CMTM1), transcript variant 16 |
CNY 3,990.00 |