Parathyroid Hormone (PTH) (NM_000315) Human Tagged ORF Clone
CAT#: RC219848
PTH (Myc-DDK-tagged)-Human parathyroid hormone (PTH)
ORF Plasmid: tGFP
"NM_000315" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
Cited in 3 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | FIH1; PTH1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC219848 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATACCTGCAAAAGACATGGCTAAAGTTATGATTGTCATGTTGGCAATTTGTTTTCTTACAAAATCGG ATGGGAAATCTGTTAAGAAGAGATCTGTGAGTGAAATACAGCTTATGCATAACCTGGGAAAACATCTGAA CTCGATGGAGAGAGTAGAATGGCTGCGTAAGAAGCTGCAGGATGTGCACAATTTTGTTGCCCTTGGAGCT CCTCTAGCTCCCAGAGATGCTGGTTCCCAGAGGCCCCGAAAAAAGGAAGACAATGTCTTGGTTGAGAGCC ATGAAAAAAGTCTTGGAGAGGCAGACAAAGCTGATGTGAATGTATTAACTAAAGCTAAATCCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC219848 protein sequence
Red=Cloning site Green=Tags(s) MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGA PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000315 |
ORF Size | 345 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000315.4 |
RefSeq Size | 828 bp |
RefSeq ORF | 348 bp |
Locus ID | 5741 |
UniProt ID | P01270 |
Protein Families | Druggable Genome, Secreted Protein |
MW | 12.9 kDa |
Gene Summary | This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Production and evaluation of parathyroid hormone receptor1 ligands with intrinsic or assembled peroxidase domains
,Charest-Morin, X;Poubelle, PE;Marceau, F;,
Sci Rep
,PubMed ID 29026164
[Parathyroid Hormone]
|
Novel Autosomal Dominant PTH Gene Signal Sequence Mutation in a Family with Familial Isolated Hypoparathyroidism
,Cinque, L;Sparaneo, A;Penta, L;Mencarelli, A;Rogaia, D;Esposito, S;Fabrizio, FP;Baorda, F;Verrotti, A;Stangoni, AF;Hendy, GN;Guarnieri, V;Prontera, P;,
The Journal of Clinical Endocrinology & Metabolism
,PubMed ID 28938448
[Parathyroid Hormone]
|
A tagged parathyroid hormone derivative as a carrier of antibody cargoes transported by the G protein coupled PTH1 receptor
,Charest-Morin, X;Fortin, JP;Lodge, R;Allaeys, I;Poubelle, PE;Marceau, F;,
Peptides
,PubMed ID 25128082
[Parathyroid Hormone]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC219848L1 | Lenti ORF clone of Human parathyroid hormone (PTH), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC219848L2 | Lenti ORF clone of Human parathyroid hormone (PTH), mGFP tagged |
CNY 5,890.00 |
|
RC219848L3 | Lenti ORF clone of Human parathyroid hormone (PTH), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC219848L4 | Lenti ORF clone of Human parathyroid hormone (PTH), mGFP tagged |
CNY 5,890.00 |
|
RG219848 | PTH (tGFP-tagged) - Human parathyroid hormone (PTH) |
CNY 4,370.00 |
|
SC300045 | PTH (untagged)-Human parathyroid hormone (PTH) |
CNY 1,200.00 |
其它Parathyroid Hormone产品