EMA (MUC1) (NM_002456) Human Tagged ORF Clone
CAT#: RC221340
- TrueORF®
MUC1 (Myc-DDK-tagged)-Human mucin 1, cell surface associated (MUC1), transcript variant 1
ORF Plasmid: tGFP
"NM_002456" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,990.00
Cited in 7 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ADMCKD; ADMCKD1; ADTKD2; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221340 representing NM_002456
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACACCGGGCACCCAGTCTCCTTTCTTCCTGCTGCTGCTCCTCACAGTGCTTACAGTTGTTACAGGTT CTGGTCATGCAAGCTCTACCCCAGGTGGAGAAAAGGAGACTTCGGCTACCCAGAGAAGTTCAGTGCCCAG CTCTACTGAGAAGAATGCTTTGTCTACTGGGGTCTCTTTCTTTTTCCTGTCTTTTCACATTTCAAACCTC CAGTTTAATTCCTCTCTGGAAGATCCCAGCACCGACTACTACCAAGAGCTGCAGAGAGACATTTCTGAAA TGTTTTTGCAGATTTATAAACAAGGGGGTTTTCTGGGCCTCTCCAATATTAAGTTCAGGCCAGGATCTGT GGTGGTACAATTGACTCTGGCCTTCCGAGAAGGTACCATCAATGTCCACGACGTGGAGACACAGTTCAAT CAGTATAAAACGGAAGCAGCCTCTCGATATAACCTGACGATCTCAGACGTCAGCGTGAGTGATGTGCCAT TTCCTTTCTCTGCCCAGTCTGGGGCTGGGGTGCCAGGCTGGGGCATCGCGCTGCTGGTGCTGGTCTGTGT TCTGGTTGCGCTGGCCATTGTCTATCTCATTGCCTTGGCTGTCTGTCAGTGCCGCCGAAAGAACTACGGG CAGCTGGACATCTTTCCAGCCCGGGATACCTACCATCCTATGAGCGAGTACCCCACCTACCACACCCATG GGCGCTATGTGCCCCCTAGCAGTACCGATCGTAGCCCCTATGAGAAGGTTTCTGCAGGTAATGGTGGCAG CAGCCTCTCTTACACAAACCCAGCAGTGGCAGCCACTTCTGCCAACTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC221340 representing NM_002456
Red=Cloning site Green=Tags(s) MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSFFFLSFHISNL QFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFN QYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYG QLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002456 |
ORF Size | 819 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002456.6 |
RefSeq Size | 1209 bp |
RefSeq ORF | 822 bp |
Locus ID | 4582 |
UniProt ID | P15941 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
MW | 29.59 kDa |
Gene Summary | This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011] |
Citations (7)
The use of this cDNA Clones has been cited in the following citations: |
---|
An intrinsic purine metabolite AICAR blocks lung tumour growth by targeting oncoprotein mucin 1
,null,
British Journal of Cancer
,PubMed ID 36810913
[EMA]
|
Crosstalk of NF-κB/P65 and LncRNA HOTAIR-Mediated Repression of MUC1 Expression Contribute to Synergistic Inhibition of Castration-Resistant Prostate Cancer by Polyphyllin 1-Enzalutamide Combination Treatment
,Xiang, S;Zou, P;Wu, J;Zheng, F;Tang, Q;Zhou, J;Hann, SS;,
Cell. Physiol. Biochem.
,PubMed ID 29807357
[EMA]
|
Mucin 1 promotes radioresistance in hepatocellular carcinoma cells through activation of JAK2/STAT3 signaling
,Yi, FT;Lu, QP;,
Oncology Letters
[EMA]
|
STAT3 inhibitor enhances chemotherapy drug efficacy by modulating mucin 1 expression in non-small cell lung carcinoma
,Han, Y;Lu, X;Wang, G;,
Tropical Journal of Pharmaceutical Research
[EMA]
|
Activation of AMPK mediates additive effects of solamargine and metformin on suppressing MUC1 expression in castration-resistant prostate cancer cells
,SongTaoXiang, ;Zhang, Q;QingTang, ;Zheng, F;JingJingWu, ;LiJunYang, ;Hann, SS;,
Scientific Report
,PubMed ID 27830724
[EMA]
|
Cigarette Smoke Mediates Nuclear to Cytoplasmic Trafficking of Transcriptional Inhibitor Kaiso through MUC1 and P120-Catenin
,Zhang, L;Gallup, M;Zlock, L;Feeling Chen, YT;Finkbeiner, WE;McNamara, NA;,
Am. J. Pathol.
,PubMed ID 27765636
[EMA]
|
Mucin 1-mediated chemo-resistance in lung cancer cells
,Ham, SY;Kwon, T;Bak, Y;Yu, JH;Hong, J;Lee, SK;Yu, DY;Yoon, DY;,
Oncogenesis
,PubMed ID 26779808
[EMA]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221340L1 | Lenti ORF clone of Human mucin 1, cell surface associated (MUC1), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC221340L2 | Lenti ORF clone of Human mucin 1, cell surface associated (MUC1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC221340L3 | Lenti ORF clone of Human mucin 1, cell surface associated (MUC1), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC221340L4 | Lenti ORF clone of Human mucin 1, cell surface associated (MUC1), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG221340 | MUC1 (tGFP-tagged) - Human mucin 1, cell surface associated (MUC1), transcript variant 1 |
CNY 4,000.00 |
|
SC108321 | MUC1 (untagged)-Human mucin 1, cell surface associated (MUC1), transcript variant 1 |
CNY 2,400.00 |