THAP1 (NM_199003) Human Tagged ORF Clone
CAT#: RC222957
THAP1 (Myc-DDK-tagged)-Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2
ORF Plasmid: tGFP
"NM_199003" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DYT6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC222957 representing NM_199003
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGCAGTCCTGCTCCGCCTACGGCTGCAAGAACCGCTACGACAAGGACAAGCCCGTTTCTTTCCACA AAAAGAAGATCTTCTGGAGCCACAGGAACAGCTTCCCCCACCTCCTTTACCGCCTCCTGTTTCCCAGGTT GATGCTGCTATTGGATTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC222957 representing NM_199003
Red=Cloning site Green=Tags(s) MVQSCSAYGCKNRYDKDKPVSFHKKKIFWSHRNSFPHLLYRLLFPRLMLLLDY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_199003 |
ORF Size | 159 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_199003.1, NP_945354.1 |
RefSeq Size | 1993 bp |
RefSeq ORF | 162 bp |
Locus ID | 55145 |
UniProt ID | Q9NVV9 |
MW | 6.3 kDa |
Gene Summary | The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC222957L1 | Lenti ORF clone of Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC222957L2 | Lenti ORF clone of Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC222957L3 | Lenti ORF clone of Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC222957L4 | Lenti ORF clone of Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG222957 | THAP1 (tGFP-tagged) - Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 |
CNY 4,370.00 |
|
SC307848 | THAP1 (untagged)-Human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 |
CNY 3,990.00 |