RGS4 (NM_001113381) Human Tagged ORF Clone
CAT#: RC225010
- TrueORF®
RGS4 (Myc-DDK-tagged)-Human regulator of G-protein signaling 4 (RGS4), transcript variant 4
ORF Plasmid: tGFP
"NM_001113381" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | RGP4; SCZD9 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC225010 representing NM_001113381
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCAAAGGGCTTGCAGGTCTGCCGGCTTCTTGCTTGAGGAGTGCAAAAGATATGAAACATCGGCTAG GTTTCCTGCTGCAAAAATCTGATTCCTGTGAACACAATTCTTCCCACAACAAGAAGGACAAAGTGGTTAT TTGCCAGAGAGTGAGCCAAGAGGAAGTCAAGAAATGGGCTGAATCACTGGAAAACCTGATTAGTCATGAA TGTGAACCTGGATTCTTGCACCAGGGAAGAGACAAGCCGGAACATGCTAGAGCCTACAATAACCTGCTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC225010 representing NM_001113381
Red=Cloning site Green=Tags(s) MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHE CEPGFLHQGRDKPEHARAYNNLL myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001113381 |
ORF Size | 279 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001113381.1, NP_001106852.1 |
RefSeq ORF | 282 bp |
Locus ID | 5999 |
UniProt ID | P49798 |
Protein Families | Druggable Genome |
MW | 10.4 kDa |
Gene Summary | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC225010L3 | Lenti-ORF clone of RGS4 (Myc-DDK-tagged)-Human regulator of G-protein signaling 4 (RGS4), transcript variant 4 |
CNY 5,890.00 |
|
RC225010L4 | Lenti-ORF clone of RGS4 (mGFP-tagged)-Human regulator of G-protein signaling 4 (RGS4), transcript variant 4 |
CNY 5,890.00 |
|
RG225010 | RGS4 (tGFP-tagged) - Human regulator of G-protein signaling 4 (RGS4), transcript variant 4 |
CNY 4,370.00 |
|
SC318759 | RGS4 (untagged)-Human regulator of G-protein signaling 4 (RGS4), transcript variant 4 |
CNY 3,990.00 |