Ataxin 3 (ATXN3) (NM_001164782) Human Tagged ORF Clone
CAT#: RC228018
- TrueORF®
ATXN3 (Myc-DDK-tagged)-Human ataxin 3 (ATXN3), transcript variant ae
ORF Plasmid: tGFP
"NM_001164782" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AT3; ATX3; JOS; MJD; MJD1; SCA3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC228018 representing NM_001164782
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGTCCATCTTCCACGAGAAAACAGCAGCAAAAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGGGG GACCTATCAGGACAGAGTTCACATCCATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC228018 representing NM_001164782
Red=Cloning site Green=Tags(s) MESIFHEKTAAKAATAAAAAAAGGPIRTEFTSM myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001164782 |
ORF Size | 99 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001164782.2 |
RefSeq ORF | 102 bp |
Locus ID | 4287 |
Protein Families | Druggable Genome, Transcription Factors |
MW | 3.1 kDa |
Gene Summary | Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC228018L3 | Lenti-ORF clone of ATXN3 (Myc-DDK-tagged)-Human ataxin 3 (ATXN3), transcript variant ae |
CNY 5,890.00 |
|
RC228018L4 | Lenti-ORF clone of ATXN3 (mGFP-tagged)-Human ataxin 3 (ATXN3), transcript variant ae |
CNY 5,890.00 |
|
RG228018 | ATXN3 (tGFP-tagged) - Human ataxin 3 (ATXN3), transcript variant ae |
CNY 4,370.00 |
|
SC326653 | ATXN3 (untagged)-Human ataxin 3 (ATXN3) transcript variant ae |
CNY 3,990.00 |
其它Ataxin 3产品