ASXL1 (NM_001164603) Human Tagged ORF Clone
CAT#: RC228030
ASXL1 (Myc-DDK-tagged)-Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2
ORF Plasmid: tGFP
"NM_001164603" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BOPS; MDS |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC228030 representing NM_001164603
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGGACAAACAGAAGAAGAAGAAGGAGCGCACGTGGGCCGAGGCCGCGCGCCTGGTATTAGAAAACT ACTCGGATGCTCCAATGACACCAAAACAGATTCTGCAGGTCATAGAGGCAGAAGGACTAAAGGAAATGAG AAGTGGGACTTCCCCTCTCGCATGCCTCAATGCTATGCTACATTCCAATTCAAGAGGAGGAGAGGGGTTG TTTTATAAACTGCCTGGCCGAATCAGCCTTTTCACGCTCAAGGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC228030 representing NM_001164603
Red=Cloning site Green=Tags(s) MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGL FYKLPGRISLFTLKV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001164603 |
ORF Size | 255 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001164603.1, NP_001158075.1 |
RefSeq ORF | 258 bp |
Locus ID | 171023 |
MW | 9.4 kDa |
Gene Summary | This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC228030L1 | Lenti ORF clone of Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC228030L2 | Lenti ORF clone of Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2, mGFP tagged |
CNY 3,600.00 |
|
RC228030L3 | Lenti ORF clone of Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC228030L4 | Lenti ORF clone of Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2, mGFP tagged |
CNY 3,600.00 |
|
RG228030 | ASXL1 (tGFP-tagged) - Human additional sex combs like 1 (Drosophila) (ASXL1), transcript variant 2 |
CNY 2,800.00 |
|
SC326665 | ASXL1 (untagged)-Human additional sex combs like 1 (Drosophila) (ASXL1) transcript variant 2 |
CNY 3,990.00 |