G protein beta subunit like (MLST8) (NM_001199175) Human Tagged ORF Clone

CAT#: RC233765

  • TrueORF®

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001199175" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


MLST8 Rabbit polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

热销推荐

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms GbetaL; GBL; LST8; POP3; WAT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC233765 representing NM_001199175
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACACCTCCCCAGGCACGGTGGGCAGTGACCCGGTCATCCTGGCCACTGCAGGCTACGACCACACCG
TGCGCTTCTGGCAGGCCCACAGCGGCATCTGCACCCGGACGGTGCAGCACCAGGACTCCGTGAATGCCTT
GGAGGTCACACCGGACCGCAGCATGATTGCTGCTGCAGGTTACCAGCACATCCGCATGTATGATCTCAAC
TCCAATAACCCTAACCCCATCATCAGCTACGACGGCGTCAACAAGAACATCGCGTCTGTGGGCTTCCACG
AAGACGGCCGCTGGATGTACACGGGCGGCGAGGACTGCACAGCCAGGATCTGGGACCTCAGGTCCCGGAA
CCTGCAGTGCCAGCGGATCTTCCAGGTGAACGCACCCATTAACTGCGTGTGCCTGCACCCCAACCAGGCA
GAGCTCATCGTGGGTGACCAGAGCGGGGCTATCCACATCTGGGACTTGAAAACAGACCACAACGAGCAGC
TGATCCCTGAGCCCGAGGTCTCCATCACGTCCGCCCACATCGATCCCGACGCCAGCTACATGGCAGCTGT
CAATAGCACCGGAAACTGCTATGTCTGGAATCTGACGGGGGGCATTGGTGACGAGGTGACCCAGCTCATC
CCCAAGACTAAGATCCCTGCCCACACGCGCTACGCCCTGCAGTGTCGCTTCAGCCCCGACTCCACGCTCC
TCGCCACCTGCTCGGCTGATCAGACGTGCAAGATCTGGAGGACGTCCAACTTCTCCCTGATGACGGAGCT
GAGCATCAAGAGCGGCAACCCCGGGGAGTCCTCCCGCGGCTGGATGTGGGGCTGCGCCTTCTCGGGGGAC
TCCCAGTACATCGTCACTGCTTCCTCGGACAACCTGGCCCGGCTCTGGTGTGTGGAGACTGGAGAGATCA
AGAGAGAGTATGGCGGCCACCAGAAGGCTGTTGTCTGCCTGGCCTTCAATGACAGTGTGCTGGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC233765 representing NM_001199175
Red=Cloning site Green=Tags(s)

MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSVNALEVTPDRSMIAAAGYQHIRMYDLN
SNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQA
ELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLI
PKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGD
SQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001199175
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001199175.3
RefSeq Size 1928 bp
RefSeq ORF 978 bp
Locus ID 64223
UniProt ID Q9BVC4
Protein Pathways mTOR signaling pathway
MW 36.2 kDa
Gene Summary Subunit of both mTORC1 and mTORC2, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, LST8 interacts directly with MTOR and enhances its kinase activity. In nutrient-poor conditions, stabilizes the MTOR-RPTOR interaction and favors RPTOR-mediated inhibition of MTOR activity. mTORC2 is also activated by growth factors, but seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...