C1orf41 (HSPB11) (NM_016126) Human Tagged ORF Clone

CAT#: RG202693

  • TrueORF®

HSPB11 (tGFP-tagged) - Human heat shock protein family B (small), member 11 (HSPB11)

ORF Plasmid: DDK tGFP



  "NM_016126" in other vectors (5)

Need custom modification / cloning service?
Get a free quote

CNY 2,800.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


HSPB11 rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms C1orf41; FAP232; HSPCO34; IFT25; PP25
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG202693 representing NM_016126
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAAAAATTGATCTCTGTCTGAGCTCTGAAGGGTCCGAAGTGATTTTAGCTACATCAAGTGATGAAA
AACACCCACCTGAAAATATCATTGATGGGAATCCAGAAACGTTTTGGACCACCACAGGAATGTTTCCCCA
GGAATTCATTATTTGTTTCCACAAACATGTAAGGATTGAAAGGCTTGTAATCCAAAGTTACTTTGTACAG
ACCTTGAAGATTGAAAAAAGCACGTCTAAAGAGCCAGTTGATTTTGAGCAATGGATTGAAAAAGATTTGG
TACACACAGAGGGGCAGCTTCAAAATGAAGAAATTGTGGCACATGATGGCTCCGCTACTTACTTGAGATT
CATTATTGTATCAGCCTTTGATCATTTTGCATCTGTGCATAGCGTTTCTGCAGAAGGAACAGTAGTCTCA
AATCTTTCCTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202693 representing NM_016126
Red=Cloning site Green=Tags(s)

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ
TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS
NLSS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016126
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016126.4
RefSeq Size 601 bp
RefSeq ORF 435 bp
Locus ID 51668
UniProt ID Q9Y547
Gene Summary Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...