WBP5 (TCEAL9) (NM_001006613) Human Tagged ORF Clone

CAT#: RG203456

  • TrueORF®

WBP5 (tGFP-tagged) - Human WW domain binding protein 5 (WBP5), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001006613" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


TCEAL9 rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms WBP5; WEX6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203456 representing NM_001006613
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAATCCTGTCAAAAAATGGAAGGAAAACCAGAAAATGAGAGTGAACCAAAGCATGAGGAAGAGCCAA
AGCCTGAGGAAAAGCCAGAAGAGGAGGAGAAGCTAGAGGAGGAGGCCAAAGCAAAAGGAACTTTTAGAGA
AAGGCTGATTCAATCTCTCCAGGAGTTTAAAGAAGATATACACAACAGGCATTTAAGCAATGAAGATATG
TTTAGAGAAGTGGATGAAATAGATGAGATAAGGAGAGTCAGAAACAAACTTATAGTGATGCGTTGGAAGG
TTAATCGAAACCATCCTTACCCCTATTTAATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203456 representing NM_001006613
Red=Cloning site Green=Tags(s)

MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM
FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001006613
ORF Size 312 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001006613.2
RefSeq Size 1023 bp
RefSeq ORF 315 bp
Locus ID 51186
UniProt ID Q9UHQ7
Gene Summary The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...