SNRPE (NM_003094) Human Tagged ORF Clone

CAT#: RG210556

  • TrueORF®

SNRPE (tGFP-tagged) - Human small nuclear ribonucleoprotein polypeptide E (SNRPE)

ORF Plasmid: DDK tGFP



  "NM_003094" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,800.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit anti-SNRPE Polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 2,700.00

热销推荐

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms HYPT11; Sm-E; SME; snRNP-E
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG210556 representing NM_003094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTACCGTGGCCAGGGTCAGAAAGTGCAGAAGGTTATGGTGCAGCCCATCAACCTCATCTTCAGAT
ACTTACAAAATAGATCGCGGATTCAGGTGTGGCTCTATGAGCAAGTGAATATGCGGATAGAAGGCTGTAT
CATTGGTTTTGATGAGTATATGAACCTTGTATTAGATGATGCAGAAGAGATTCATTCTAAAACAAAGTCA
AGAAAACAACTGGGTCGGATCATGCTAAAAGGAGATAATATTACTCTGCTACAAAGTGTCTCCAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210556 representing NM_003094
Red=Cloning site Green=Tags(s)

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS
RKQLGRIMLKGDNITLLQSVSN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003094
ORF Size 276 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003094.4
RefSeq Size 1593 bp
RefSeq ORF 279 bp
Locus ID 6635
UniProt ID P62304
Domains Sm
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Gene Summary The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...