Interferon beta (IFNB1) (NM_002176) Human Tagged ORF Clone
CAT#: RG218565
- TrueORF®
IFNB1 (tGFP-tagged) - Human interferon, beta 1, fibroblast (IFNB1)
ORF Plasmid: DDK
"NM_002176" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 5,200.00
CNY 1,000.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | IFB; IFF; IFN-beta; IFNB |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG218565 representing NM_002176
Red=Cloning site Green=Tags(s) MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQ FQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002176 |
ORF Size | 561 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002176.4 |
RefSeq Size | 840 bp |
RefSeq ORF | 564 bp |
Locus ID | 3456 |
UniProt ID | P01574 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Gene Summary | This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection. [provided by RefSeq, Sep 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC218565 | IFNB1 (Myc-DDK-tagged)-Human interferon, beta 1, fibroblast (IFNB1) |
CNY 3,600.00 |
|
RC218565L1 | Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC218565L2 | Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), mGFP tagged |
CNY 6,000.00 |
|
RC218565L3 | Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC218565L4 | Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), mGFP tagged |
CNY 6,000.00 |
|
SC127861 | IFNB1 (untagged)-Human interferon, beta 1, fibroblast (IFNB1) |
CNY 3,600.00 |
其它Interferon beta产品