E1B 21.1 kDa protein (NC_012959) Virus Tagged ORF Clone
CAT#: VC100148
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for E1B 211 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038599
View other clones from "Virus" (35)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100148 represents NCBI reference of YP_003038599 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATGTTTGGAGCATACTCGGCGAGTTCAATAAAACAAGACGCCTGGTGGAGGATTCAAGCGATGGGT GTTCCGGATTCTGGAGGCACTGGTTCGGCACCCCTCTCAGTAGACTGGTTTATACCGTAAAGAAAGACTA CAGCGAAGAATTCGAAAACCTGTTCGCGGACTGCTCCGGACTGCTCGATTCCCTGAATTTTGGACACCAG AGCCTGTTCCAGGAGCGCGTGTTGCACTCATTGGACTTCTCTAGCCCCGGCCGAACCACCGCAGGCGTTG CTTTTGTAGTGTTCCTGGTGGATAAATGGTCACAAGATACCCAGCTTTCCAGGGGCTACATCCTCGACTT TGCGGCTATGCATCTCTGGCGAGCGTGGATGCGCCAGAGAGGACAAAGGATCCTGAATTACTGGCTCCTT CAGCCTGCCGCCTCAGGCCTCCTGCACCTGCATAGACAGACCTCTATGCTGGAGGAAGAGATGCGCGAAG CCATGGATGAGAACCCCAGGAGCGGGTTGGATCCCCCTAGCGAGGAGGAGCTCGAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100148 representing YP_003038599
Red=Cloning sites Green=Tags MDVWSILGEFNKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQ SLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWRAWMRQRGQRILNYWLL QPAASGLLHLHRQTSMLEEEMREAMDENPRSGLDPPSEEELD TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_012959 |
ORF Size | 546 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_012959.1, YP_003038599 |
RefSeq ORF | 546 bp |
MW | 21.1 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100146 | Myc-DDK-tagged ORF clone of viral ORF for early E1A 13s [Human adenovirus 54], codon optimized for human cell expression, YP_003038597 |
CNY 2,640.00 |
|
VC100147 | Myc-DDK-tagged ORF clone of viral ORF for Early E1A 12s [Human adenovirus 54], codon optimized for human cell expression, YP_003038598 |
CNY 3,800.00 |
|
VC100149 | Myc-DDK-tagged ORF clone of viral ORF for E1B 55 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038600 |
CNY 5,990.00 |
|
VC100150 | Myc-DDK-tagged ORF clone of viral ORF for pIX [Human adenovirus 54], codon optimized for human cell expression, YP_003038601 |
CNY 3,800.00 |
|
VC100151 | Myc-DDK-tagged ORF clone of viral ORF for pIVa2 [Human adenovirus 54], codon optimized for human cell expression, YP_003038602 |
CNY 5,510.00 |
|
VC100152 | Myc-DDK-tagged ORF clone of viral ORF for polymerase [Human adenovirus 54], codon optimized for human cell expression, YP_003038603 |
CNY 16,530.00 |
|
VC100153 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 54], codon optimized for human cell expression, YP_003038604 |
CNY 7,600.00 |
|
VC100154 | Myc-DDK-tagged ORF clone of viral ORF for 52/55K [Human adenovirus 54], codon optimized for human cell expression, YP_003038605 |
CNY 4,470.00 |
|
VC100155 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 54], codon optimized for human cell expression, YP_003038606 |
CNY 6,840.00 |
|
VC100156 | Myc-DDK-tagged ORF clone of viral ORF for penton [Human adenovirus 54], codon optimized for human cell expression, YP_003038607 |
CNY 6,270.00 |
|
VC100157 | Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 54], codon optimized for human cell expression, YP_003038608 |
CNY 3,800.00 |
|
VC100158 | Myc-DDK-tagged ORF clone of viral ORF for pV [Human adenovirus 54], codon optimized for human cell expression, YP_003038609 |
CNY 3,800.00 |
|
VC100159 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 54], codon optimized for human cell expression, YP_003038610 |
CNY 3,800.00 |
|
VC100160 | Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 54], codon optimized for human cell expression, YP_003038611 |
CNY 3,800.00 |
|
VC100161 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 54], codon optimized for human cell expression, YP_003038612 |
CNY 14,350.00 |
|
VC100162 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 54], codon optimized for human cell expression, YP_003038613 |
CNY 3,800.00 |
|
VC100163 | Myc-DDK-tagged ORF clone of viral ORF for DNA binding protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038614 |
CNY 5,990.00 |
|
VC100164 | Myc-DDK-tagged ORF clone of viral ORF for 802 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038615 |
CNY 10,740.00 |
|
VC100165 | Myc-DDK-tagged ORF clone of viral ORF for 145 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038616 |
CNY 3,800.00 |
|
VC100166 | Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 54], codon optimized for human cell expression, YP_003038617 |
CNY 3,800.00 |
|
VC100167 | Myc-DDK-tagged ORF clone of viral ORF for 122 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038618 |
CNY 3,800.00 |
|
VC100168 | Myc-DDK-tagged ORF clone of viral ORF for 209 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038619 |
CNY 3,800.00 |
|
VC100169 | Myc-DDK-tagged ORF clone of viral ORF for 176 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038620 |
CNY 3,800.00 |
|
VC100170 | Myc-DDK-tagged ORF clone of viral ORF for 445 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038621 |
CNY 5,130.00 |
|
VC100171 | Myc-DDK-tagged ORF clone of viral ORF for 293 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038622 |
CNY 3,800.00 |
|
VC100172 | Myc-DDK-tagged ORF clone of viral ORF for 105 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038623 |
CNY 3,800.00 |
|
VC100173 | Myc-DDK-tagged ORF clone of viral ORF for 142 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038624 |
CNY 3,800.00 |
|
VC100174 | Myc-DDK-tagged ORF clone of viral ORF for 147 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038625 |
CNY 3,800.00 |
|
VC100175 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 54], codon optimized for human cell expression, YP_003038626 |
CNY 4,280.00 |
|
VC100176 | Myc-DDK-tagged ORF clone of viral ORF for 34 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038627 |
CNY 3,800.00 |
|
VC100177 | Myc-DDK-tagged ORF clone of viral ORF for 85 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038628 |
CNY 3,800.00 |
|
VC100178 | Myc-DDK-tagged ORF clone of viral ORF for 141 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038629 |
CNY 3,800.00 |
|
VC100179 | Myc-DDK-tagged ORF clone of viral ORF for 136 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038630 |
CNY 3,800.00 |
|
VC100180 | Myc-DDK-tagged ORF clone of viral ORF for 145 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038631 |
CNY 3,800.00 |
|
VC100181 | Myc-DDK-tagged ORF clone of viral ORF for 73 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038632 |
CNY 3,800.00 |
其它E1B 21.1 kDa protein产品