HECV-4408 E Gene Tagged ORF Clone
CAT#: VC100663
- TrueORF®
Myc-DDK-tagged ORF clone for envelope protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038526
View other clones from "HECV-4408" (9)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100663 represents NCBI reference of YP_003038526 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTATGGCTGACGCCTACTTTGCTGATACCGTTTGGTACGTTGGACAAATCATCTTTATAGTGGCAA TCTGTTTGTTGGTTATCATCGTCGTGGTTGCCTTTCTGGCCACATTTAAACTCTGTATTCAGCTGTGCGG GATGTGTAATACCCTCGTTCTCTCACCTTCAATCTATGTCTTCAATCGCGGAAGGCAGTTTTATGAGTTT TATAATGACGTGAAGCCCCCAGTACTCGATGTGGATGACGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100663 representing YP_003038526
Red=Cloning sites Green=Tags MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYVFNRGRQFYEF YNDVKPPVLDVDDV TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_012950 |
ORF Size | 252 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_012950.1, YP_003038526 |
RefSeq ORF | 252 bp |
MW | 9.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100657 | Myc-DDK-tagged ORF clone for 32 kD non-structural protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038520 |
CNY 3,800.00 |
|
VC100658 | Myc-DDK-tagged ORF clone for hemagglutinin-esterase [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038521 |
CNY 5,230.00 |
|
VC100659 | Myc-DDK-tagged ORF clone for spike protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038522 |
CNY 20,520.00 |
|
VC100660 | Myc-DDK-tagged ORF clone for 49 kD non-structural protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038523 |
CNY 3,800.00 |
|
VC100661 | Myc-DDK-tagged ORF clone for 48 kD non-structural protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038524 |
CNY 3,800.00 |
|
VC100662 | Myc-DDK-tagged ORF clone for 127 kD non-structural protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038525 |
CNY 3,800.00 |
|
VC100664 | Myc-DDK-tagged ORF clone for membrane protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038527 |
CNY 3,800.00 |
|
VC100665 | Myc-DDK-tagged ORF clone for nucleocapsid protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038528 |
CNY 5,488.00 |
|
VC100666 | Myc-DDK-tagged ORF clone for internal protein [Human enteric coronavirus strain 4408], codon optimized for human cell expression, YP_003038529 |
CNY 3,800.00 |
其它envelope protein产品