U74 (NC_000898) Virus Tagged ORF Clone
CAT#: VC101513
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050253
View other clones from "Virus" (98)
Need custom modification / cloning service?
Get a free quote
CNY 7,890.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101513 represents NCBI reference of NP_050253 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCACCTTAGGGGGTGTGCTTGCCACCTGTCTCTCTACTGTGTGTATAACGATTGGGAGAACAAGATCT ATCGCGTGCCTATATTTCAGTGTCTGTTCCTCGAGGCCGAAACCCGATCACTGAAGACGTTCCTCATACG AGGCCAGTCCCTGGATCAGGAGTCTCTGAATGAAATAGAGGTTACCCGAAAAGAGACCATGCTTTGGGAT CTGCAGGAGCAGAGTAATATGATGGATAAGAAGATCGCCGCAATCAGTTCCCTCATTATGAATAACGGAG AGCTCCTTAGAAAACTTTCTAAATTCTTTGTTCCATTGACCGTCGTCCTGGGCGACGACGGGTTGGAGAT CCTTGAGGCTTATGTGTGCGGGGAGGAACCGATGCTGCCACTTGACACAGTGCCAGTAATCCTGCGGTGC GTCGGCGACTATGCCGCCCTCGACACTAAGCATCTGCTCAGTAATGAGTGCACACAGGCATCCAAGAAAC TCAGGTTCGGGTATTCTGTGATGGATTTCCACTTCTCCCTTACTGTGTCCGACGTGAAGATATGCTTCTC CCACACCGATACAGGTGAAGCAGTTTGCGAGAAAATGAAGCAGATATTCTACTTCTCTGTATGTGCCTTT GGTGGAGAACAGGTCCTGCTTGTGACTCCCAAAAACGCCTACGCCCTGCTTTTCGATGACGACCTTTGTT TGCTCCTCTTGCAATCCGTTTTTGCCTTCTTGCACGAGAAAATCTTCGCAGTCTACAAGCAGGTCCTGGT GCAGCTCTGCGAGTACATCGGACCTGACTTGTGGCCATTCGGTAACGAGCGCAGCGTATCTTTCATAGGT TACCCCAATCTCTGGCTGCTGAGCGTGAGTGACCTGGAGAGGCGCGTGCCTGATACCACATACATTTGTA GAGAGATCCTGTCATTTTGTGGTCTGGCCCCTATACTGGGTCCTAGAGGAAGGCACGCAATTCCCGTCAT CCGGGAACTTTCTGTAGAAATGCCAGGGAGCGAGACCAGTCTGCAGCGCTTCCGGTTCAACAGTCAATAC GTATCTTCCGAATCTCTCTGTTTTCAGACTGGTCCCGAAGACACCCACTTGTTCTTCAGCGATTCCGATA TGTACGTCGTGACCCTGCCCGATTGCCTTCGCCTGTTGCTTAAGTCCACGGTGCCACGCGCGTTTCTGCC GTGCTTCGATGAAAACGCCACGGAAATCGAACTGCTTCTTAAATTCATGTCCAGGCTGCAGCATAGGAGC TACGCTCTTTTTGACGCCGTCATCTTCATGCTCGACGCATTTGTGAGCGCCTTTCAGCGGGCATGCACAC TCATGGAGATGCGCTGGCTCTTGGTCAGAGACCTGCACGTTTTCTACCTGACATGTGACGGAAAGGATAG CCACGTTGTGATGCCCCTGCTGCAGACCGCCGTGGAAAATTGTTGGGAAAAGATCACCGAAATAAAACAG AGGCCTGCCTTTCAATGTATGGAAATTTCACGGTGCGGGTTTGTGTTCTACGCTAGATTCTTTTTGAGCT CCGGGCTCTCCCAGTCAAAGGAAGCTCACTGGACAGTGACTGCGAGTAAATATTTGTCCGCCTGCATCAG GGCTAATAAGACCGGTTTGTGCTTCGCCTCCATCACTGTGTACTTTCAGGATATGATGTGCGTATTCATA GCAAATAGGTATAATGTCTCTTATTGGATCGAGGAGTTTGATCCAAACGACTACTGTCTGGAGTATCACG AGGGCCTCCTGGATTGTAGTCGATACACCGCCGTCATGAGTGAAGACGGTCAGCTGGTGCGGCAGGCCAG AGGCATAGCCCTCACTGATAAAATTAACTTTTCCTACTACATATTGGTCACCCTGAGGGTTCTTCGCCGC TGGGTGGAGAGTAAGTTCGAAGATGTGGAGCAAGCTGAGTTTATCAGGTGGGAGAATCGCATGCTCTATG AACACATTCACCTGCTGCATCTCAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101513 representing NP_050253
Red=Cloning sites Green=Tags MHLRGCACHLSLYCVYNDWENKIYRVPIFQCLFLEAETRSLKTFLIRGQSLDQESLNEIEVTRKETMLWD LQEQSNMMDKKIAAISSLIMNNGELLRKLSKFFVPLTVVLGDDGLEILEAYVCGEEPMLPLDTVPVILRC VGDYAALDTKHLLSNECTQASKKLRFGYSVMDFHFSLTVSDVKICFSHTDTGEAVCEKMKQIFYFSVCAF GGEQVLLVTPKNAYALLFDDDLCLLLLQSVFAFLHEKIFAVYKQVLVQLCEYIGPDLWPFGNERSVSFIG YPNLWLLSVSDLERRVPDTTYICREILSFCGLAPILGPRGRHAIPVIRELSVEMPGSETSLQRFRFNSQY VSSESLCFQTGPEDTHLFFSDSDMYVVTLPDCLRLLLKSTVPRAFLPCFDENATEIELLLKFMSRLQHRS YALFDAVIFMLDAFVSAFQRACTLMEMRWLLVRDLHVFYLTCDGKDSHVVMPLLQTAVENCWEKITEIKQ RPAFQCMEISRCGFVFYARFFLSSGLSQSKEAHWTVTASKYLSACIRANKTGLCFASITVYFQDMMCVFI ANRYNVSYWIEEFDPNDYCLEYHEGLLDCSRYTAVMSEDGQLVRQARGIALTDKINFSYYILVTLRVLRR WVESKFEDVEQAEFIRWENRMLYEHIHLLHLN TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_000898 |
ORF Size | 1986 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_000898.1, NP_050253 |
RefSeq ORF | 1986 bp |
Locus ID | 1497074 |
MW | 76.5 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101440 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase II [Human herpesvirus 6], codon optimized for human cell expression, NP_050176 |
CNY 11,500.00 |
|
VC101441 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050180 |
CNY 4,660.00 |
|
VC101442 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp004 [Human herpesvirus 6], codon optimized for human cell expression, NP_050179 |
CNY 3,800.00 |
|
VC101443 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp003 [Human herpesvirus 6], codon optimized for human cell expression, NP_050178 |
CNY 3,800.00 |
|
VC101444 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp002 [Human herpesvirus 6], codon optimized for human cell expression, NP_050177 |
CNY 3,800.00 |
|
VC101445 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp006 [Human herpesvirus 6], codon optimized for human cell expression, NP_050181 |
CNY 3,800.00 |
|
VC101447 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050183 |
CNY 3,800.00 |
|
VC101448 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050185 |
CNY 4,560.00 |
|
VC101449 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp009 [Human herpesvirus 6], codon optimized for human cell expression, NP_050186 |
CNY 6,460.00 |
|
VC101450 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp014 [Human herpesvirus 6], codon optimized for human cell expression, NP_050188 |
CNY 3,800.00 |
|
VC101451 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp012 [Human herpesvirus 6], codon optimized for human cell expression, NP_050189 |
CNY 4,940.00 |
|
VC101452 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp015 [Human herpesvirus 6], codon optimized for human cell expression, NP_050190 |
CNY 3,800.00 |
|
VC101453 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp016 [Human herpesvirus 6], codon optimized for human cell expression, NP_050191 |
CNY 6,080.00 |
|
VC101454 | Myc-DDK-tagged ORF clone of viral ORF for antigenic virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050192 |
CNY 9,424.00 |
|
VC101455 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp019 [Human herpesvirus 6], codon optimized for human cell expression, NP_050194 |
CNY 3,800.00 |
|
VC101456 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp020 [Human herpesvirus 6], codon optimized for human cell expression, NP_050195 |
CNY 7,320.00 |
|
VC101457 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 6 [Human herpesvirus 6], codon optimized for human cell expression, NP_050198 |
CNY 3,800.00 |
|
VC101458 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 4 [Human herpesvirus 6], codon optimized for human cell expression, NP_050199 |
CNY 4,660.00 |
|
VC101459 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050200 |
CNY 5,320.00 |
|
VC101460 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050201 |
CNY 6,080.00 |
|
VC101461 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp013 [Human herpesvirus 6], codon optimized for human cell expression, NP_050187 |
CNY 13,590.00 |
|
VC101462 | Myc-DDK-tagged ORF clone of viral ORF for transcription regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_050197 |
CNY 3,990.00 |
|
VC101463 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050202 |
CNY 3,800.00 |
|
VC101464 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp027 [Human herpesvirus 6], codon optimized for human cell expression, NP_050204 |
CNY 1,200.00 |
|
VC101465 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp026 [Human herpesvirus 6], codon optimized for human cell expression, NP_050205 |
CNY 3,800.00 |
|
VC101466 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp025 [Human herpesvirus 6], codon optimized for human cell expression, NP_050206 |
CNY 3,800.00 |
|
VC101467 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp033 [Human herpesvirus 6], codon optimized for human cell expression, NP_050207 |
CNY 3,800.00 |
|
VC101468 | Myc-DDK-tagged ORF clone of viral ORF for Polymerase processivity factor [Human herpesvirus 6], codon optimized for human cell expression, NP_050208 |
CNY 4,370.00 |
|
VC101469 | Myc-DDK-tagged ORF clone of viral ORF for large ribonuclease reductase [Human herpesvirus 6], codon optimized for human cell expression, NP_050209 |
CNY 12,260.00 |
|
VC101470 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly and DNA maturation [Human herpesvirus 6], codon optimized for human cell expression, NP_050210 |
CNY 3,800.00 |
|
VC101471 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050211 |
CNY 16,340.00 |
|
VC101473 | Myc-DDK-tagged ORF clone of viral ORF for putative capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050213 |
CNY 3,800.00 |
|
VC101474 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050214 |
CNY 5,700.00 |
|
VC101475 | Myc-DDK-tagged ORF clone of viral ORF for putative virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050215 |
CNY 3,800.00 |
|
VC101476 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp038 [Human herpesvirus 6], codon optimized for human cell expression, NP_050216 |
CNY 3,800.00 |
|
VC101477 | Myc-DDK-tagged ORF clone of viral ORF for virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050217 |
CNY 5,890.00 |
|
VC101478 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp043 [Human herpesvirus 6], codon optimized for human cell expression, NP_050218 |
CNY 3,800.00 |
|
VC101479 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050219 |
CNY 15,390.00 |
|
VC101480 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_050220 |
CNY 12,640.00 |
|
VC101481 | Myc-DDK-tagged ORF clone of viral ORF for transport/capsid assembly [Human herpesvirus 6], codon optimized for human cell expression, NP_050221 |
CNY 10,930.00 |
|
VC101482 | Myc-DDK-tagged ORF clone of viral ORF for major DNA binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050222 |
CNY 17,100.00 |
|
VC101483 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050223 |
CNY 6,270.00 |
|
VC101484 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050224 |
CNY 13,020.00 |
|
VC101485 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp050 [Human herpesvirus 6], codon optimized for human cell expression, NP_050225 |
CNY 3,800.00 |
|
VC101486 | Myc-DDK-tagged ORF clone of viral ORF for putative dUTPase [Human herpesvirus 6], codon optimized for human cell expression, NP_050226 |
CNY 4,470.00 |
|
VC101487 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane /secreted protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050227 |
CNY 3,800.00 |
|
VC101488 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_050228 |
CNY 11,120.00 |
|
VC101489 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_050229 |
CNY 10,450.00 |
|
VC101490 | Myc-DDK-tagged ORF clone of viral ORF for putative fusion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050230 |
CNY 3,800.00 |
|
VC101491 | Myc-DDK-tagged ORF clone of viral ORF for viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050231 |
CNY 6,750.00 |
|
VC101492 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050232 |
CNY 3,800.00 |
|
VC101493 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp058 [Human herpesvirus 6], codon optimized for human cell expression, NP_050233 |
CNY 3,800.00 |
|
VC101494 | Myc-DDK-tagged ORF clone of viral ORF for proteinase [Human herpesvirus 6], codon optimized for human cell expression, NP_050234 |
CNY 6,370.00 |
|
VC101495 | Myc-DDK-tagged ORF clone of viral ORF for virion transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050235 |
CNY 5,610.00 |
|
VC101496 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp062 [Human herpesvirus 6], codon optimized for human cell expression, NP_050236 |
CNY 5,990.00 |
|
VC101497 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050237 |
CNY 3,800.00 |
|
VC101498 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050238 |
CNY 20,330.00 |
|
VC101499 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp064 [Human herpesvirus 6], codon optimized for human cell expression, NP_050239 |
CNY 11,690.00 |
|
VC101500 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp065 [Human herpesvirus 6], codon optimized for human cell expression, NP_050240 |
CNY 4,180.00 |
|
VC101501 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp067 [Human herpesvirus 6], codon optimized for human cell expression, NP_050242 |
CNY 3,800.00 |
|
VC101502 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp068 [Human herpesvirus 6], codon optimized for human cell expression, NP_050243 |
CNY 3,800.00 |
|
VC101503 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050244 |
CNY 5,420.00 |
|
VC101504 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050245 |
CNY 3,990.00 |
|
VC101505 | Myc-DDK-tagged ORF clone of viral ORF for Putative terminase [Human herpesvirus 6], codon optimized for human cell expression, NP_050241 |
CNY 7,980.00 |
|
VC101506 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp071 [Human herpesvirus 6], codon optimized for human cell expression, NP_050246 |
CNY 4,180.00 |
|
VC101507 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp072 [Human herpesvirus 6], codon optimized for human cell expression, NP_050247 |
CNY 3,800.00 |
|
VC101508 | Myc-DDK-tagged ORF clone of viral ORF for Phosphotransferase [Human herpesvirus 6], codon optimized for human cell expression, NP_050248 |
CNY 6,840.00 |
|
VC101509 | Myc-DDK-tagged ORF clone of viral ORF for Alkaline exonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_050249 |
CNY 5,990.00 |
|
VC101510 | Myc-DDK-tagged ORF clone of viral ORF for Myristylated virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050250 |
CNY 3,800.00 |
|
VC101511 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_050251 |
CNY 4,090.00 |
|
VC101512 | Myc-DDK-tagged ORF clone of viral ORF for origin binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050252 |
CNY 11,880.00 |
|
VC101514 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp080 [Human herpesvirus 6], codon optimized for human cell expression, NP_050254 |
CNY 3,800.00 |
|
VC101515 | Myc-DDK-tagged ORF clone of viral ORF for putative viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050255 |
CNY 7,890.00 |
|
VC101516 | Myc-DDK-tagged ORF clone of viral ORF for Helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050256 |
CNY 12,540.00 |
|
VC101517 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp082 [Human herpesvirus 6], codon optimized for human cell expression, NP_050257 |
CNY 3,800.00 |
|
VC101518 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp083 [Human herpesvirus 6], codon optimized for human cell expression, NP_050258 |
CNY 3,800.00 |
|
VC101519 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication [Human herpesvirus 6], codon optimized for human cell expression, NP_050259 |
CNY 5,890.00 |
|
VC101520 | Myc-DDK-tagged ORF clone of viral ORF for Uracyl-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_050260 |
CNY 3,800.00 |
|
VC101521 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_050261 |
CNY 3,800.00 |
|
VC101522 | Myc-DDK-tagged ORF clone of viral ORF for Intercrine cytokine [Human herpesvirus 6], codon optimized for human cell expression, NP_050262 |
CNY 3,800.00 |
|
VC101523 | Myc-DDK-tagged ORF clone of viral ORF for putative glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050263 |
CNY 4,090.00 |
|
VC101524 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050264 |
CNY 3,800.00 |
|
VC101526 | Myc-DDK-tagged ORF clone of viral ORF for IE-A transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050266 |
CNY 16,340.00 |
|
VC101527 | Myc-DDK-tagged ORF clone of viral ORF for probable membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050267 |
CNY 3,800.00 |
|
VC101529 | Myc-DDK-tagged ORF clone of viral ORF for Parvovirus rep homolog [Human herpesvirus 6], codon optimized for human cell expression, NP_050269 |
CNY 4,024.00 |
|
VC101530 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein IE2 [Human herpesvirus 6], codon optimized for human cell expression, NP_050270 |
CNY 18,340.00 |
|
VC101531 | Myc-DDK-tagged ORF clone of viral ORF for spliced envelope glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050271 |
CNY 7,410.00 |
|
VC101533 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050273 |
CNY 11,500.00 |
|
VC101534 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp099 [Human herpesvirus 6], codon optimized for human cell expression, NP_050274 |
CNY 3,800.00 |
|
VC101535 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp100 [Human herpesvirus 6], codon optimized for human cell expression, NP_050275 |
CNY 3,800.00 |
|
VC101536 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp101 [Human herpesvirus 6], codon optimized for human cell expression, NP_050276 |
CNY 3,800.00 |
|
VC101537 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050277 |
CNY 4,660.00 |
|
VC101538 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp103 [Human herpesvirus 6], codon optimized for human cell expression, NP_050278 |
CNY 3,800.00 |
|
VC101539 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050203 |
CNY 3,800.00 |
|
VC101540 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp021 [Human herpesvirus 6], codon optimized for human cell expression, NP_050196 |
CNY 3,800.00 |
|
VC101541 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050193 |
CNY 3,800.00 |
|
VC101542 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050184 |
CNY 4,370.00 |
|
VC101543 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor fragment [Human herpesvirus 6], codon optimized for human cell expression, NP_597817 |
CNY 3,800.00 |