Replication protein E1 fragment (NC_001593) Virus Tagged ORF Clone
CAT#: VC101977
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for Replication protein E1 fragment [Human papillomavirus type 53], codon optimized for human cell expression, NP_597793
View other clones from "Virus" (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101977 represents NCBI reference of NP_597793 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACGTCGATCGACAGGATATCATGCCCCTGCAACAGATTCAGGATATTCTTAAATGTTCTAACGTGC AGGCCAAACTCTATTGCAAATTCAAGGACATCTTCGGCATTCCTTTCAGCGAATTGGTGAGAACTTTTAA GTCTGACAGTACATGTTGCCATGATTGGATCTGCGCCATATTTGGCGTTAACGAGCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101977 representing NP_597793
Red=Cloning sites Green=Tags MDVDRQDIMPLQQIQDILKCSNVQAKLYCKFKDIFGIPFSELVRTFKSDSTCCHDWICAIFGVNEH TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001593 |
ORF Size | 198 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001593.1, NP_597793 |
RefSeq ORF | 198 bp |
Locus ID | 1724566 |
MW | 7.7 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101971 | Myc-DDK-tagged ORF clone of viral ORF for early protein [Human papillomavirus type 53], codon optimized for human cell expression, NP_041844 |
CNY 3,800.00 |
|
VC101972 | Myc-DDK-tagged ORF clone of viral ORF for early protein [Human papillomavirus type 53], codon optimized for human cell expression, NP_041845 |
CNY 3,800.00 |
|
VC101973 | Myc-DDK-tagged ORF clone of viral ORF for early protein [Human papillomavirus type 53], codon optimized for human cell expression, NP_041846 |
CNY 4,560.00 |
|
VC101974 | Myc-DDK-tagged ORF clone of viral ORF for late protein [Human papillomavirus type 53], codon optimized for human cell expression, NP_041847 |
CNY 5,700.00 |
|
VC101975 | Myc-DDK-tagged ORF clone of viral ORF for late protein [Human papillomavirus type 53], codon optimized for human cell expression, NP_041848 |
CNY 6,080.00 |
|
VC101976 | Myc-DDK-tagged ORF clone of viral ORF for Replication protein E1 fragment [Human papillomavirus type 53], codon optimized for human cell expression, NP_597792 |
CNY 3,800.00 |
其它Replication protein E1 fragment产品