Coronavirus IBV nsp3 (HD2) Gene Tagged ORF Clone
CAT#: VC102254
- TrueORF®
Myc-DDK-tagged ORF clone for coronavirus nsp3 (HD2) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740624
View other clones from "Coronavirus IBV" (19)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102254 represents NCBI reference of NP_740624 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCTCATTCGTCCGGAAAGCAACCTCCTGGTTCTGGTCCCGGTGCGTGCTCGCCTGCTTCCTCTTCG TTCTGTGCGCCATCGTGCTGTTTACCGCTGTGCCCTTGAAGTTTTACGTATACGCTGCAGTAATCCTTCT TATGGCTGTGCTCTTCATCAGTTTTACCGTCAAGCACGTAATGGCCTACATGGACACTTTCCTGTTGCCT ACCCTCATCACTGTGATCATCGGAGTTTGCGCCGAAGTCCCTTTCATCTACAACACACTCATCTCTCAGG TGGTGATCTTCCTGTCTCAGTGGTATGATCCAGTTGTGTTCGACACCATGGTGCCTTGGATGTTCCTCCC ATTGGTCCTGTATACCGCTTTTAAATGTGTCCAGGGATGTTATATGAACTCCTTTAATACCTCTTTGCTT ATGCTCTATCAGTTTGTCAAGCTGGGGTTCGTTATCTACACCAGCTCAAATACGCTCACCGCCTATACAG AGGGCAACTGGGAGCTGTTCTTCGAGCTCGTCCACACGACTGTACTCGCTAACGTGTCATCTAACTCCCT GATTGGCCTGTTTGTGTTTAAGTGCGCCAAATGGATGCTGTATTACTGTAACGCCACTTATCTGAACAAT TACGTCCTCATGGCTGTGATGGTCAACTGCATTGGATGGCTGTGTACTTGTTACTTTGGACTTTACTGGT GGGTCAATAAGGTGTTTGGCCTTACACTGGGGAAGTATAACTTCAAAGTGTCTGTAGACCAGTATCGGTA CATGTGCCTGCACAAAATCAACCCCCCGAAGACCGTGTGGGAAGTGTTCAGTACCAACATCTTGATCCAG GGTATTGGCGGGGACCGGGTCTTGCCAATCGCTACTGTCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102254 representing NP_740624
Red=Cloning sites Green=Tags MSSFVRKATSWFWSRCVLACFLFVLCAIVLFTAVPLKFYVYAAVILLMAVLFISFTVKHVMAYMDTFLLP TLITVIIGVCAEVPFIYNTLISQVVIFLSQWYDPVVFDTMVPWMFLPLVLYTAFKCVQGCYMNSFNTSLL MLYQFVKLGFVIYTSSNTLTAYTEGNWELFFELVHTTVLANVSSNSLIGLFVFKCAKWMLYYCNATYLNN YVLMAVMVNCIGWLCTCYFGLYWWVNKVFGLTLGKYNFKVSVDQYRYMCLHKINPPKTVWEVFSTNILIQ GIGGDRVLPIATVQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001451 |
ORF Size | 882 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001451.1, NP_740624 |
RefSeq ORF | 882 bp |
MW | 33.9 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102242 | Myc-DDK-tagged ORF clone of viral ORF for spike protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040831 |
CNY 17,480.00 |
|
VC102243 | Myc-DDK-tagged ORF clone of viral ORF for 3a protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040832 |
CNY 3,800.00 |
|
VC102244 | Myc-DDK-tagged ORF clone of viral ORF for 3b protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040833 |
CNY 3,800.00 |
|
VC102245 | Myc-DDK-tagged ORF clone of viral ORF for small virion-associated protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040834 |
CNY 3,800.00 |
|
VC102246 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040835 |
CNY 3,800.00 |
|
VC102247 | Myc-DDK-tagged ORF clone of viral ORF for 5a protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040836 |
CNY 3,800.00 |
|
VC102248 | Myc-DDK-tagged ORF clone of viral ORF for 5b protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040837 |
CNY 3,800.00 |
|
VC102249 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040838 |
CNY 4,940.00 |
|
VC102251 | Myc-DDK-tagged ORF clone for coronavirus nsp8 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740621 |
CNY 3,800.00 |
|
VC102253 | Myc-DDK-tagged ORF clone for coronavirus nsp2 (3CL-Pro) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740623 |
CNY 2,640.00 |
|
VC102255 | Myc-DDK-tagged ORF clone for coronavirus nsp4 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740625 |
CNY 3,800.00 |
|
VC102256 | Myc-DDK-tagged ORF clone for coronavirus nsp5 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740626 |
CNY 3,800.00 |
|
VC102257 | Myc-DDK-tagged ORF clone for coronavirus nsp6 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740627 |
CNY 3,800.00 |
|
VC102258 | Myc-DDK-tagged ORF clone for coronavirus nsp7 (GLF) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740628 |
CNY 3,800.00 |
|
VC102260 | Myc-DDK-tagged ORF clone for coronavirus nsp10 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740630 |
CNY 7,220.00 |
|
VC102261 | Myc-DDK-tagged ORF clone for coronavirus nsp11 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740631 |
CNY 6,370.00 |
|
VC102262 | Myc-DDK-tagged ORF clone for coronavirus nsp12 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740632 |
CNY 4,090.00 |
|
VC102263 | Myc-DDK-tagged ORF clone for coronavirus nsp13 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740633 |
CNY 3,800.00 |
|
VC102264 | Myc-DDK-tagged ORF clone of viral ORF for leader protein p87 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740634 |
CNY 10,170.00 |
其它coronavirus nsp3 (HD2)产品