DCXR (NM_016286) Human Mass Spec Standard
CAT#: PH300023
DCXR MS Standard C13 and N15-labeled recombinant protein (NP_057370)
View other "DCXR" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DCXR MS Standard C13 and N15-labeled recombinant protein (NP_057370) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200023 |
Predicted MW | 25.9 kDa |
Protein Sequence |
>RC200023 protein sequence
Red=Cloning site Green=Tags(s) MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057370 |
RefSeq Size | 860 |
RefSeq ORF | 732 |
Synonyms | DCR; HCR2; HCRII; KIDCR; P34H; PNTSU; SDR20C1; XR |
Locus ID | 51181 |
Cytogenetics | 17q25.3 |
Summary | The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal renal tubules. Defects in this gene are a cause of pentosuria. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pentose and glucuronate interconversions |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402535 | DCXR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434088 | DCXR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402535 | Transient overexpression lysate of dicarbonyl/L-xylulose reductase (DCXR) |
CNY 3,080.00 |
|
LY434088 | Transient overexpression lysate of dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2 |
CNY 3,080.00 |
|
TP300023 | Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR), 20 µg |
CNY 2,900.00 |
|
TP720249 | Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2. |
CNY 3,140.00 |