NDUFA8 (NM_014222) Human Mass Spec Standard
CAT#: PH300061
NDUFA8 MS Standard C13 and N15-labeled recombinant protein (NP_055037)
View other "NDUFA8" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NDUFA8 MS Standard C13 and N15-labeled recombinant protein (NP_055037) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200061 |
Predicted MW | 20.1 kDa |
Protein Sequence |
>RC200061 protein sequence
Red=Cloning site Green=Tags(s) MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDF FRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPEN PYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055037 |
RefSeq Size | 859 |
RefSeq ORF | 516 |
Synonyms | CI-19KD; CI-PGIV; MC1DN37; PGIV |
Locus ID | 4702 |
Cytogenetics | 9q33.2 |
Summary | The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415437 | NDUFA8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415437 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP300061 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
|
TP761555 | Purified recombinant protein of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |