United States
Germany
Japan
United Kingdom
China
CUTA (NM_001014838) Human Mass Spec Standard
CAT＃: PH300075
CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014838)
View other "CUTA" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014838) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200075 |
| Predicted MW | 16.8 kDa |
| Protein Sequence |
>RC200075 protein sequence
Red=Cloning site Green=Tags(s) MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRL AACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQW VRQVTESVSDSITVLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001014838 |
| RefSeq Size | 1041 |
| RefSeq ORF | 468 |
| Synonyms | ACHAP; C6orf82 |
| Locus ID | 51596 |
| Cytogenetics | 6p21.32 |
| Summary | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414324 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423090 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423091 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414324 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2 |
CNY 3,080.00 |
|
| LY423090 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3 |
CNY 3,080.00 |
|
| LY423091 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4 |
CNY 3,080.00 |
|
| PH310646 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837) |
CNY 19,520.00 |
|
| PH319077 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_057005) |
CNY 19,520.00 |
|
| TP300075 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP310646 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP319077 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720228 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 1 |
CNY 3,140.00 |
